[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0280
DDBJ      :CPE0280      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  888/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
c.90.1
:280 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->92 3hh1B PDBj 7e-21 52.3 %
:BLT:PDB   112->221 3ffyA PDBj 2e-20 45.8 %
:RPS:PDB   1->224 1cbfA PDBj 1e-51 17.5 %
:RPS:SCOP  3->219 1wyzA1  c.90.1.1 * 9e-48 22.3 %
:HMM:SCOP  1->220 1wyzA1 c.90.1.1 * 5.4e-83 54.1 %
:RPS:PFM   4->201 PF00590 * TP_methylase 6e-20 36.6 %
:HMM:PFM   3->202 PF00590 * TP_methylase 2.1e-40 30.8 195/210  
:BLT:SWISS 4->274 Y049_BACHD 4e-73 53.0 %
:PROS 81->92|PS01296|UPF0011

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79986.1 GT:GENE CPE0280 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 359922..360764 GB:FROM 359922 GB:TO 360764 GB:DIRECTION + GB:GENE CPE0280 GB:PRODUCT conserved hypothetical protein GB:NOTE 280 aa, similar to gpu:AP001507_49 BH0049 gene product from Bacillus halodurans (289 aa); 52.4% identity in 271 aa overlap GB:PROTEIN_ID BAB79986.1 LENGTH 280 SQ:AASEQ MSKVYLVPTPIGNLGDITLRALEVLKSVDLIAAEDTRQTLKLLNHFEIKKPLISYHKHNEQGKGEEILRRVKEGTSVAIVSDAGTPGISDPGSVVVEKCIEEGIEFEVLPGATAFTTALIYSGLDTTKFMFKGFFPRENKDKRSFIEDIKDRTETIIIYESPYRILDTIDTLKEGLGNRKVAICRELTKLHEEIFRGTLEEAKIHFEENAPKGEFVCVISGKTDKEIEEENTSKWISMSIEEHIIHYIDNEGMKKKDAIKQVAKDRGVAKSEIYKFSLDI GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 4->274|Y049_BACHD|4e-73|53.0|268/289| PROS 81->92|PS01296|UPF0011|PDOC00998| BL:PDB:NREP 2 BL:PDB:REP 4->92|3hh1B|7e-21|52.3|88/111| BL:PDB:REP 112->221|3ffyA|2e-20|45.8|107/110| RP:PDB:NREP 1 RP:PDB:REP 1->224|1cbfA|1e-51|17.5|223/239| RP:PFM:NREP 1 RP:PFM:REP 4->201|PF00590|6e-20|36.6|194/206|TP_methylase| HM:PFM:NREP 1 HM:PFM:REP 3->202|PF00590|2.1e-40|30.8|195/210|TP_methylase| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00590|IPR000878| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF00590|IPR000878| RP:SCP:NREP 1 RP:SCP:REP 3->219|1wyzA1|9e-48|22.3|206/223|c.90.1.1| HM:SCP:REP 1->220|1wyzA1|5.4e-83|54.1|220/0|c.90.1.1|1/1|Tetrapyrrole methylase| OP:NHOMO 994 OP:NHOMOORG 910 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111112111111111111111--111111111111111111111111111111111222111222222222121111111111111121112121111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111112111-111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111----------111111111111111----1111111222222232222222222222222222211112122111111122211221212222222222222211111111111111111111111111111111112111111111111111-11111111111111111111111111111111111111111--11111111--111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122222221111111111111111-11111111111111111111111111111111 --------211-------------------------------------------------------------------------------------------------21-----------------------------------------------------------------11111111111212-11------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 90.0 SQ:SECSTR TcEEEEEEcccccGGGccHHHHHHHHHccEEEEcTTTccHHHHTTccTTcEEEEcTTccHHHHHHHHHHHHTTTccEEEEEccccTTTTcccHHHHHHHHHTTcEEEEEccccHHHHHHcccTTTcccEEEEEccccccccGGGcHHHHHTTccEEEEEccTTcHHHHHHHHHHTcTTcEEEEEEcTTcTTcEEEEEEGGGHHHHHHHTTccccEEEEEcGGGcGGGcHHTcHHHHHcccGGGGccHHHHTT############################ PSIPRED ccEEEEEEcccccHHHccHHHHHHHHHccEEEEccccccHHHHHHcccccEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccEEcHHHHHHHHHHHccccEEEEccccHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEccHHHHHHHHHHccccccEEEEEccccccccccccHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHcc //