[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0307
DDBJ      :CPE0307      probable lipase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  113/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:334 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   42->277 1jjiA PDBj 7e-10 28.5 %
:RPS:PDB   63->328 2c7bB PDBj 3e-15 19.4 %
:RPS:SCOP  66->159 2pblA1  c.69.1.2 * 1e-18 22.4 %
:RPS:SCOP  250->328 1l7aA  c.69.1.25 * 2e-06 15.1 %
:HMM:SCOP  64->315 2bceA_ c.69.1.1 * 1.1e-41 26.9 %
:RPS:PFM   95->170 PF07859 * Abhydrolase_3 1e-05 34.7 %
:RPS:PFM   249->309 PF00326 * Peptidase_S9 1e-06 39.7 %
:HMM:PFM   95->309 PF07859 * Abhydrolase_3 6e-19 22.3 202/211  
:BLT:SWISS 42->173 YR526_MIMIV 2e-09 32.5 %
:BLT:SWISS 249->314 ACPH_HUMAN 4e-05 32.3 %
:PROS 172->197|PS00217|SUGAR_TRANSPORT_2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80013.1 GT:GENE CPE0307 GT:PRODUCT probable lipase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 390238..391242 GB:FROM 390238 GB:TO 391242 GB:DIRECTION + GB:GENE CPE0307 GB:PRODUCT probable lipase GB:NOTE 334 aa, similar to pir:T43794 probable lipase lipA from Clostridium perfringens (311 aa); 23.1% identity in 260 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB80013.1 LENGTH 334 SQ:AASEQ MKKILKVVEVILLSLIIIMGALAYYFRGQIGFYINIGKEYLEFKENPPSIEDLKNIKMSEDMDFKDVVYKDTNGKAQTLDIYGPEKKLRHGSPVILYVHGGSWVYGNKEIPDLIAPLLDSFRKEGYTIISVGYELATDKVDFKKQASDVKDAIRWVYKNKETYGFNTDEIGVIGASAGAHLSLLATYSGEDEFVDDKELSNYPSKVKYVVDFFGPTELSALDMTMASWDLNNSIEKTEKQLRGEESITEYMDKYSPINYVKPNLPKTLIVHGRQDKLVPYSNSMNLYNKSKDMGNDIQILTLENSGHDFSQVDVNEVFELGFKVLNFILFNTKF GT:EXON 1|1-334:0| BL:SWS:NREP 2 BL:SWS:REP 42->173|YR526_MIMIV|2e-09|32.5|123/346| BL:SWS:REP 249->314|ACPH_HUMAN|4e-05|32.3|65/732| PROS 172->197|PS00217|SUGAR_TRANSPORT_2|PDOC00190| TM:NTM 1 TM:REGION 4->26| SEG 2->18|kkilkvvevillsliii| SEG 174->185|gasagahlslla| BL:PDB:NREP 1 BL:PDB:REP 42->277|1jjiA|7e-10|28.5|221/311| RP:PDB:NREP 1 RP:PDB:REP 63->328|2c7bB|3e-15|19.4|253/286| RP:PFM:NREP 2 RP:PFM:REP 95->170|PF07859|1e-05|34.7|72/205|Abhydrolase_3| RP:PFM:REP 249->309|PF00326|1e-06|39.7|58/208|Peptidase_S9| HM:PFM:NREP 1 HM:PFM:REP 95->309|PF07859|6e-19|22.3|202/211|Abhydrolase_3| GO:PFM:NREP 4 GO:PFM GO:0008152|"GO:metabolic process"|PF07859|IPR013094| GO:PFM GO:0016787|"GO:hydrolase activity"|PF07859|IPR013094| GO:PFM GO:0006508|"GO:proteolysis"|PF00326|IPR001375| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF00326|IPR001375| RP:SCP:NREP 2 RP:SCP:REP 66->159|2pblA1|1e-18|22.4|85/261|c.69.1.2| RP:SCP:REP 250->328|1l7aA|2e-06|15.1|73/318|c.69.1.25| HM:SCP:REP 64->315|2bceA_|1.1e-41|26.9|245/579|c.69.1.1|1/1|alpha/beta-Hydrolases| OP:NHOMO 152 OP:NHOMOORG 120 OP:PATTERN --------------1---------1----3-------------------------------------- -12------------2222-21--2-2222221-----23-11---------1---------1--1---------1-1-----------------------1-11--1-1---------------1------------------2-11-------------------111---------------------------------1-------221---------11------1-------------------11-1--11-2-11--2211---11----------------------------------------------------1---1--11-1-----22211-----1------------------1--4------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1-----------------------------1--1------------------------------------11-----------------------------------111-----------------------------111111111111---------------1-----------------11111111----------------------11-11111---------------------------------------------------------------------------11--1---1---- ------------11------------------------------------------------------------------------------------------2----2----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 311 STR:RPRED 93.1 SQ:SECSTR #######################HHHHGGGccTccGGGcccccccccccccEEccTTccTTTEEEEEEEEETTETTEEEEEEEEEccccccEEEEEEEcccTTTcccTGGGHHHHHHHHHHHHHTcEEEEEEcccTTTTccTTHHHHHHHHHHHHHHHTHHHHTEEEEEEEEEEETHHHHHHHHHHHHHHHHTcccccEEEEEccccccccccHHHHHHHHcTTccccHHcHHHHHHHHHHccccGGGGcTHTTcGGGcccTTcccEEEEEEEEcTTHHHHHHHHHHHHHHHTTccEEEEEEEEETTGGGGGGGcHHHHHHHHHHHHHHHHHHH PSIPRED cHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHcccccHHHcccccccccccEEEEEEcccccccEEEEEEEccccccccccEEEEEcccccEEccccccccHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccccHHHcccHHHHHHHHHccccccHHHHHHHcHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHccc //