[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0308
DDBJ      :CPE0308      MutS-like protein
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  768/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
a.113.1c.37.1
:521 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->143 3bbeA PDBj 2e-04 29.0 %
:BLT:PDB   298->507 1nneB PDBj 4e-23 30.7 %
:RPS:PDB   304->456 2dwoA PDBj 1e-04 14.0 %
:RPS:SCOP  53->112 1ewrA1  a.113.1.1 * 1e-06 33.3 %
:RPS:SCOP  297->520 1e3mA2  c.37.1.12 * 4e-10 20.9 %
:HMM:SCOP  41->103 1e3mA1 a.113.1.1 * 2.2e-05 31.7 %
:HMM:SCOP  296->521 1e3mA2 c.37.1.12 * 2.3e-34 27.7 %
:RPS:PFM   298->510 PF00488 * MutS_V 3e-24 35.2 %
:HMM:PFM   297->518 PF00488 * MutS_V 1.1e-36 31.4 220/234  
:HMM:PFM   53->104 PF05192 * MutS_III 3.6e-07 28.8 52/219  
:HMM:PFM   189->232 PF00218 * IGPS 0.00081 11.4 44/255  
:BLT:SWISS 11->143 Y079_METJA 1e-04 26.9 %
:BLT:SWISS 250->516 MUTS_THEP1 7e-27 33.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80014.1 GT:GENE CPE0308 GT:PRODUCT MutS-like protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 391401..392966 GB:FROM 391401 GB:TO 392966 GB:DIRECTION + GB:GENE CPE0308 GB:PRODUCT MutS-like protein GB:NOTE 521 aa, similar to N-terminal of sp:MUTS_THEMA DNA MISMATCH REPAIR PROTEIN MUTS from Thermotoga maritima (793 aa); 32.2% identity in 267 aa overlap. 2 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80014.1 LENGTH 521 SQ:AASEQ MDKRLLKVLKHDYAVEMDKKRNLKAIRTLYDMNEKEEYHIDEQTWNDLDLDKVYSKLDRNYSSLGEASLYSMLRNPLNDEKKLNKRREEIEYFKENEEVRFKIMWIFFELGRDKKNSLLDMINEKLIESNKFKYYFYTITGKILPLILILTAIFVSVSAMLGLMAVTFLNIYINSKERDRIKANGLMYLRRVIKASKQIVKINDKNLDDFNIKIRENLKDLKSIDRNTIMISFINMWGGVFEFISVLFLLEETAYYKIADSIEKNKDSILSLYKTLGEMEAIISIGSYEEEKKDKITRPKFIREITLEIKNGIHPIIENPVANSINMSKRGIVLTGTNMSGKSTFLRMLGVNMLFAQAFNFVLAEKYEGPIFNIVTSISPNDDLSVGKSFYMAEAESILRIIRALDKELPVFCAIDEIFRGTNPIERISASAEILTYINNKNSISIVATHDRELVDILKESYEFYYFSENVDSKNGLSFDYKLKRGVSKTRNAIKLLEYIGYPKDIINKSYRRSEKLEGFI GT:EXON 1|1-521:0| BL:SWS:NREP 2 BL:SWS:REP 11->143|Y079_METJA|1e-04|26.9|130/380| BL:SWS:REP 250->516|MUTS_THEP1|7e-27|33.0|261/793| TM:NTM 2 TM:REGION 143->165| TM:REGION 228->250| BL:PDB:NREP 2 BL:PDB:REP 37->143|3bbeA|2e-04|29.0|107/204| BL:PDB:REP 298->507|1nneB|4e-23|30.7|205/759| RP:PDB:NREP 1 RP:PDB:REP 304->456|2dwoA|1e-04|14.0|150/449| RP:PFM:NREP 1 RP:PFM:REP 298->510|PF00488|3e-24|35.2|210/229|MutS_V| HM:PFM:NREP 3 HM:PFM:REP 297->518|PF00488|1.1e-36|31.4|220/234|MutS_V| HM:PFM:REP 53->104|PF05192|3.6e-07|28.8|52/219|MutS_III| HM:PFM:REP 189->232|PF00218|0.00081|11.4|44/255|IGPS| GO:PFM:NREP 3 GO:PFM GO:0005524|"GO:ATP binding"|PF00488|IPR000432| GO:PFM GO:0006298|"GO:mismatch repair"|PF00488|IPR000432| GO:PFM GO:0030983|"GO:mismatched DNA binding"|PF00488|IPR000432| RP:SCP:NREP 2 RP:SCP:REP 53->112|1ewrA1|1e-06|33.3|60/98|a.113.1.1| RP:SCP:REP 297->520|1e3mA2|4e-10|20.9|211/223|c.37.1.12| HM:SCP:REP 41->103|1e3mA1|2.2e-05|31.7|60/297|a.113.1.1|1/1|DNA repair protein MutS, domain III| HM:SCP:REP 296->521|1e3mA2|2.3e-34|27.7|224/234|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1891 OP:NHOMOORG 977 OP:PATTERN ------------------------22222222-----------1111111111--------------- 322-------------------------------------------------------------------------------11121133221211311122132725121111111111111111111111-1111111111122112111111221111111112111111111111111121111221111222221222222222211111222221121211111122233333333333333133331222222113211112221211112222222223221222222222222222222222223222222222122334434445243424423347322123211222223231212212321121--111111111111111111111111111111-11-111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-11111111111111111111111111111111111--111111-11111111111211111111111111111211111111111111-11121111231222111---------------------11-111111111111111111111111111111111-1211111-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111211111111111111-111111111111111111111111-1111111111111111111111111111111111111111111111--1122222211111111112-------------------------1233321122111 3322562-83213455544345543344434444434444443444544542332232322244345424553435535665566644-4555545556535555426337464524321143-56181ef6-6344132423422341351264754535D4455-221322664--2I332-151355453244441 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 404 STR:RPRED 77.5 SQ:SECSTR ####################################ccccccHHHHTGGGccHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHTHHHHHHHHHHHcccccTcccTTEEEHHHHHHHTTccEEEEEEEEEEE################################################################################cccccTTTccccGGGGTccccccccTHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHHHHHHHHHHHHGGHTccccEEccEEEcTTTcEcEEEcccccccccccccccEEEEccTTccHHHHHHHHEHHHHHHHHHcccccGGGGcTTcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHEHTcEEEEEEEEcccHHHHHHHHHHHTTTcGGGTTcEcHHHHHHHHHHGGGTTTEEEEEcccEEETTEEEcccccEEcccccccHHHHHHHTTccHHHHHHHHHHHHHHHTc# DISOP:02AL 217-222| PSIPRED cccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEHHHHccHHccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccEEEEEEccccccccccccEEEcccEEEEEEccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEcccccHHHccHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHcccccEEEEEEEEEccccEEEEEEEEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHHcc //