[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0310
DDBJ      :CPE0310      probable lactate permease
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  402/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:507 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->486 PF02652 * Lactate_perm 2e-71 41.9 %
:HMM:PFM   7->501 PF02652 * Lactate_perm 6.9e-140 41.0 493/522  
:BLT:SWISS 53->447 LCTP_STRIN e-109 49.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80016.1 GT:GENE CPE0310 GT:PRODUCT probable lactate permease GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 393902..395425 GB:FROM 393902 GB:TO 395425 GB:DIRECTION + GB:GENE CPE0310 GB:PRODUCT probable lactate permease GB:NOTE 507 aa, similar to gp:SILCT_2 lactate premease from Streptococcus iniae (474 aa); 49.5% identity in 416 aa overlap. Putative N-terminal signal sequence and 13 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80016.1 LENGTH 507 SQ:AASEQ MNTYLMFFLALIPIIILIIGLGVLKIPAHKICPIALIITILLSIFIWKMPTIDSLTAALEGIALGIWPIMIVIIAAVFTYNLVVHTKAMEVIKSMLISVSDDKRILVLILAWGFGGFLEAVAGFGTAVAIPVGIMAALGFNPFFASVICLVANTTPTAFGAIGLPVITLANVSGIPIESLSYYVVLQLFLFVVLIPFALVALTEKSLKGIKGVFGITLASGLSFGIVQVLVAKFLGPELPAVLGSIVSLLVTIFIAKKFYKHNEETKREEKFELKSVLVAFSPFILILVIIIGISPLFPGLYNKLSEVRTSVNIYTGVGAKPYTFVWLTTPGILILIASFIGGFIQKASFREMVEILLKTIKQMSKSTITILAIIALAKVMGYSGMVASIATVLVMITGSFYAFIAPFIGALGTFVTGSDTSANVLFGSLQAEAANSLGISPAWLGAANTCGATAGKMISPQSIAVATAATGLAGKEGKILNSTLKVCIVYVILLGLISYLGSLIFV GT:EXON 1|1-507:0| BL:SWS:NREP 1 BL:SWS:REP 53->447|LCTP_STRIN|e-109|49.9|395/474| TM:NTM 15 TM:REGION 4->26| TM:REGION 29->51| TM:REGION 59->81| TM:REGION 105->127| TM:REGION 132->154| TM:REGION 157->179| TM:REGION 184->206| TM:REGION 211->233| TM:REGION 235->256| TM:REGION 277->299| TM:REGION 326->348| TM:REGION 354->376| TM:REGION 390->412| TM:REGION 434->456| TM:REGION 483->505| SEG 9->27|lalipiiiliiglgvlkip| SEG 179->194|slsyyvvlqlflfvvl| SEG 281->298|fspfililviiigisplf| SEG 368->378|titilaiiala| SEG 489->505|ivyvillglisylgsli| RP:PFM:NREP 1 RP:PFM:REP 28->486|PF02652|2e-71|41.9|456/508|Lactate_perm| HM:PFM:NREP 1 HM:PFM:REP 7->501|PF02652|6.9e-140|41.0|493/522|Lactate_perm| GO:PFM:NREP 2 GO:PFM GO:0015129|"GO:lactate transmembrane transporter activity"|PF02652|IPR003804| GO:PFM GO:0015727|"GO:lactate transport"|PF02652|IPR003804| OP:NHOMO 578 OP:NHOMOORG 423 OP:PATTERN ------1-1111111------1-1111--12------------1------------------------ -11--22-----1------------1------------1---------------121------1--1111-----------1------1111--11----1--------------------------------------11-----1--------------------------------------1-----121333333343333333132212223211-1-1------1-12222222222222211113-1------1-111----------------1----------------------------------------12--11111111113----1111-1---1--1155-31--111---1--1-21---------11111--11111-11121-11111-11111112----------------11-----1-1-----11111111---11111------------------------------------11--211212-111-22121111-22212222--111-111121--1-221----1-1111111----11--1-2112211443-1-1--12-11111----1-11-111111112222222-------1--1111-111111111111111121211-----1-1------211111-2112222222-12222232221222222211111---111-111111111111111113221------------------------------1-111111-1111111111111-1-112111111111211122----------------3111111111111----------------------11111111----------------------------------------- -------------------------------------------------------------------------------------------------------222--------------------------------------------------------------------------------------11----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 262-274| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHccccHHcHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccEEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //