[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0314
DDBJ      :CPE0314      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->110 PF10864 * DUF2663 9.4e-06 24.7 77/131  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80020.1 GT:GENE CPE0314 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(398998..399396) GB:FROM 398998 GB:TO 399396 GB:DIRECTION - GB:GENE CPE0314 GB:PRODUCT hypothetical protein GB:NOTE 132 aa, no significant homology. Putative N-terminal signal sequence and 2 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80020.1 LENGTH 132 SQ:AASEQ MPKLLIPAIIFITLALIFYTIGVWSEHRAGILKKKHVIIFWCGLVCDTLGTYTMSRIVAAGTDKGITPTDLLIHQSTGMLAIILMLIHAVWATIVLNRGSEKAKAIFHKFSLVVWFIWLIPYFVGMYIGMTS GT:EXON 1|1-132:0| TM:NTM 4 TM:REGION 3->24| TM:REGION 36->58| TM:REGION 77->99| TM:REGION 106->128| HM:PFM:NREP 1 HM:PFM:REP 32->110|PF10864|9.4e-06|24.7|77/131|DUF2663| OP:NHOMO 29 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1-------111--1-----------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------1111111111-1--1222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //