[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0329
DDBJ      :CPE0329      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.18.1
:795 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->205 2vngB PDBj 6e-99 100.0 %
:BLT:PDB   214->792 2wmiA PDBj 0.0 61.5 %
:RPS:PDB   614->795 1ddqC PDBj 2e-04 6.7 %
:RPS:SCOP  34->204 2vngA1  b.18.1.33 * 8e-81 100.0 %
:RPS:PFM   32->197 PF08305 * NPCBM 5e-12 40.6 %
:RPS:PFM   202->534 PF08306 * Glyco_hydro_98M e-106 61.4 %
:RPS:PFM   536->792 PF08307 * Glyco_hydro_98C 2e-49 50.0 %
:HMM:PFM   203->534 PF08306 * Glyco_hydro_98M 1e-158 53.6 323/324  
:HMM:PFM   536->795 PF08307 * Glyco_hydro_98C 4.2e-129 59.5 259/268  
:HMM:PFM   33->199 PF08305 * NPCBM 3e-35 40.7 140/143  
:BLT:SWISS 129->257 NIT2_HUMAN 4e-05 24.2 %
:BLT:SWISS 518->671 MURE_BORAP 8e-04 27.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80035.1 GT:GENE CPE0329 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 413725..416112 GB:FROM 413725 GB:TO 416112 GB:DIRECTION + GB:GENE CPE0329 GB:PRODUCT hypothetical protein GB:NOTE 795 aa, no significant homology. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB80035.1 LENGTH 795 SQ:AASEQ MKNNLKKYIKYILSVILVFFVGVNGMEVYALEESRDVYLSDLDWLNATHGDDTKSKIVQKNHPFTPGNNNQSTKISLKMEDGSISEFEKGLGTIAGSPSTITYDISGAGVTKFFSYLGIDRSANPINEQYAKVDKIEVVVDGKVIYSTINQFPNGLTYETPAIKVDLNIPENAKRLQLKSYAGEKTWGDEVVYADAKFTAKGDFVNPNDWTPAEKRREISNEKPLLMIPLYANGSKYEKGDYAFWGDDTLVGKWKEVPDDLKPYTVIQLHPDDLPKRDGVAADFYEHMLNEAQSYVNPKTNKNEPIPIVLTVYTAGNVPGYTAAHWLTTEWIEDMYSKYSALQGVFSTENYWVWTDNVESNAAEYLKLSAKYGGYFIWSEQNNGGSIEKAFGSNGKTVFKEAVEKYWENFIFMYKNTPQAEGNDAPTSSYMTGLWLTDYAYQWGGLMDTWKWYETGKWKLFESGNIGKTQGNRQWLTEPEALLGIEAMNIYLNGGCVYNFEHPAYTYGVRNEESPLFSNVIKEFFRYVINNPSPSKNEMRAKTKSLLYGNFTQNGNGNYFVGLNTEMSQSPAYTTGRYGNIPAVPSSIERNKIESRLSGSQIKLIDMNSSELSNITNRKEYFNKLYKEEYNGNIFAQKLDNRWFIYNYKYNENINQKGSFDIANIKSEVTLEPHTYLIMEDNNQSINIKLNNYRTNKDSLWEGAKNADEAKKLPEMSKVDALNWVYDSYIKNTNNGEKRTSVIKLMNIDKAPTITNVNGIEGSYDIPTVKYNSETRSAEITIKNNGNIDFDIVIK GT:EXON 1|1-795:0| BL:SWS:NREP 2 BL:SWS:REP 129->257|NIT2_HUMAN|4e-05|24.2|120/276| BL:SWS:REP 518->671|MURE_BORAP|8e-04|27.3|143/505| TM:NTM 1 TM:REGION 8->30| BL:PDB:NREP 2 BL:PDB:REP 33->205|2vngB|6e-99|100.0|173/173| BL:PDB:REP 214->792|2wmiA|0.0|61.5|569/572| RP:PDB:NREP 1 RP:PDB:REP 614->795|1ddqC|2e-04|6.7|180/1112| RP:PFM:NREP 3 RP:PFM:REP 32->197|PF08305|5e-12|40.6|138/141|NPCBM| RP:PFM:REP 202->534|PF08306|e-106|61.4|311/311|Glyco_hydro_98M| RP:PFM:REP 536->792|PF08307|2e-49|50.0|248/256|Glyco_hydro_98C| HM:PFM:NREP 3 HM:PFM:REP 203->534|PF08306|1e-158|53.6|323/324|Glyco_hydro_98M| HM:PFM:REP 536->795|PF08307|4.2e-129|59.5|259/268|Glyco_hydro_98C| HM:PFM:REP 33->199|PF08305|3e-35|40.7|140/143|NPCBM| RP:SCP:NREP 1 RP:SCP:REP 34->204|2vngA1|8e-81|100.0|171/171|b.18.1.33| OP:NHOMO 15 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1--------------------------------------------------------------------------------11112111111-------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 763 STR:RPRED 96.0 SQ:SECSTR ################################ccEEEEGGGccccEEccccccTTcccEEcccHHHHHTTccccEEEEcTTccEEEEccEEEEEccTTEEEEEEcTTccEEEEEEEEEEcTTcccccTTccEEcEEEEEETTEEEEETTTTcTTcEETTcccEEEEEEccTTccEEEEEEEcTTccTTcEEEEEEEEEEEcccccHHHHHHHHcccccccccccEEEEEEEccHHHHHTTccccTTcccHHHHHHHccTTTGGGEEEEEEcTTccccTTHHHHHHHHHHHHHHTcccTTTcccccccEEEEEEEGGGcTTTcGGGGccHHTccEEEEEccTTccGGGGccEEEEEEEEcccccccTTTTcEEEEEEccccccccEEEEEccEEEEEEEcTTccEEEEEEEccccccccccTTcEEEEEEEEcTTcEEEEEETTEEEEEEEcTTccccccccEEEEEEEccccTTcEEEEEEEEEEcccccHHHHHHHHHHTTcTTccccTTcccccccccEEEcccccTTcEEEEccccTTccEEEEcccccccccccccccccccccEEEEEccccccccccccTTcEEEEEEEETTEEEEEEccTTcccccccccccccccTTcccccccccccccccccccccTTTTcccEEEccccTTccccEEEcccccccccEEcccccccHHHHHHHHccccccccccccccccccTTTcTTTTTcccHHHHHHHHHHHccTTcccccccccTccTTTTcccccccGGGcccccTTTGGGGTcccccccccccccccc DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEcccccccccccccccccEEcccccccccccccEEEEEEEccccHHHHHHHHcccccccEEEEEEccccccEEHHEEEEEccccccHHHcEEEEEEEEEEEccEEEEEEcccccccEEEEcccEEEEEEccccccEEEEEEEEccccccccEEEEccEEEEEcccccHHHHHHHHHHHcccccccEEEEEEEccccccccccEEEEcccccccHHHHcHHHcccEEEEEEEHHHccccccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHEEEEcccccHHHHHHHHHHHccccEEEEEEEcccccccHHHHccccHHHHHHHHHHHHHEEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccHHHccHHHHHHHHHHHEEEcccEEEEcccccEEccccccccHHHHccHHHHHHHHHccccccHHHHHHHccEEEEEEccccccccEEEEEEcccccccHHHccccccccccccEEcHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEEccccccccccEEEccHHHHHHEEEcccEEEEEEEEcccEEEEEEEEEcccccccHHccccccccccccHHHHHHHHHHHHHccEEccccccEEEEEEEEEcccccccEEEEccccccEEccEEEEccccEEEEEEEcccccEEEEEEEc //