[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0344
DDBJ      :CPE0344      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  72/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.126.1
:265 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   32->262 1h70A PDBj 9e-10 23.4 %
:RPS:PDB   9->260 2ci3A PDBj 8e-46 21.5 %
:RPS:SCOP  11->260 1h70A  d.126.1.3 * 3e-38 19.8 %
:HMM:SCOP  1->263 1rxxA_ d.126.1.4 * 2.2e-55 30.4 %
:RPS:PFM   56->260 PF02274 * Amidinotransf 5e-16 31.8 %
:HMM:PFM   63->196 PF02274 * Amidinotransf 2.3e-34 29.1 134/382  
:HMM:PFM   209->260 PF02274 * Amidinotransf 2.5e-10 28.8 52/382  
:BLT:SWISS 9->260 YKGA_BACSU 1e-28 33.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80050.1 GT:GENE CPE0344 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 436353..437150 GB:FROM 436353 GB:TO 437150 GB:DIRECTION + GB:GENE CPE0344 GB:PRODUCT conserved hypothetical protein GB:NOTE 265 aa, similar to gpu:AP001513_52 BH1779 gene product from Bacillus halodurans (287 aa); 36.9% identity in 252 aa overlap GB:PROTEIN_ID BAB80050.1 LENGTH 265 SQ:AASEQ MEIRNNKGYGKLKTVIVCYPCNFKVKGKVQINYPLMYEQYNNFINLISGEGVKVQLLEPIYGENQVFTRDVGFVIGDTLFISSMSNKERIEETKALEKYIKNHNLKVYRMENKIEGGDVIVYENYIFVGLSKRTSLEAIKELKEYINEYNMGYEIIEINFNKEKMLHLDCVFNILGKDQCIISDYLYDKDKIKKRIKTCYNIDKKTSEELGANIVALGDGRILTSNKTVFHILKKADFEVFYLDYSEILKAGGGFTCSTLYFYIE GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 9->260|YKGA_BACSU|1e-28|33.2|247/286| BL:PDB:NREP 1 BL:PDB:REP 32->262|1h70A|9e-10|23.4|222/255| RP:PDB:NREP 1 RP:PDB:REP 9->260|2ci3A|8e-46|21.5|246/274| RP:PFM:NREP 1 RP:PFM:REP 56->260|PF02274|5e-16|31.8|201/239|Amidinotransf| HM:PFM:NREP 2 HM:PFM:REP 63->196|PF02274|2.3e-34|29.1|134/382|Amidinotransf| HM:PFM:REP 209->260|PF02274|2.5e-10|28.8|52/382|Amidinotransf| GO:PFM:NREP 2 GO:PFM GO:0005737|"GO:cytoplasm"|PF02274|IPR003198| GO:PFM GO:0016813|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines"|PF02274|IPR003198| RP:SCP:NREP 1 RP:SCP:REP 11->260|1h70A|3e-38|19.8|242/255|d.126.1.3| HM:SCP:REP 1->263|1rxxA_|2.2e-55|30.4|263/412|d.126.1.4|1/1|Pentein| OP:NHOMO 90 OP:NHOMOORG 84 OP:PATTERN --------11-1111---------------------------------------------1---1--- ---------------11--------------------------------111------------1--1------------21---------1--11---111111---------------------------------------1--1--11-----------------------------------------1---------------111111--1----1--------1-----------------------1----1-----11--1-1-11----------------------------------------------1-1-1----------1--22-11---------------------221--------------------------------------------------1-------------------------------------------------------------------------------------111111-----11--------1------------------------------1-------------------1--------------------------------------------------------------------------------------1--------------------------------------------------11---------------------------1--------------------1111------------------------------------------------------1------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------12------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 95.8 SQ:SECSTR ########TTcccEEEEEcccTTHHHHcccccHHHHHHHHHHHHHHHHTTccEEEEEcccTTTTTTcGGGGEEEETTEEEEcccccGGGTTHHHHHHHHHHHTTcEEEEcccTccGGGEEEcccEEEEEEcccccHHHHHHHHHHTTTcEETcEEEEEEEEccccccGGGcEEEEETTEEEEEccHHHHHHHHHHHccccccEEEEEccEEEEETTTEEEEEEccHHHHHHHTTcTTcEEEEcccHHHHTTTccGGGGcEEc### PSIPRED cEEEEcccccEEEEEEEEcccccEEHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccEEcccccEEEEccEEEEEccccHHHccHHHHHHHHHHHcccEEEEEcccEEEEEEEEEccEEEEEEcccccHHHHHHHHHHccccccccEEEEEEccccccEEEEEEEEEEcccEEEEcHHHccHHHHHHHcccccccccccHHHHcccEEEEcccEEEcccHHHHHHHHHcccEEEEEcHHHHHHHccccEEEEEEEEEc //