[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0363
DDBJ      :CPE0363      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->42 PF07561 * DUF1540 1.2e-12 44.7 38/40  
:HMM:PFM   77->115 PF07561 * DUF1540 2.7e-13 48.7 39/40  
:HMM:PFM   27->81 PF10455 * BAR_2 7.8e-05 28.3 53/289  
:REPEAT 2|3->31|76->104
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80069.1 GT:GENE CPE0363 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 464641..464997 GB:FROM 464641 GB:TO 464997 GB:DIRECTION + GB:GENE CPE0363 GB:PRODUCT hypothetical protein GB:NOTE 118 aa, no significant homology. GB:PROTEIN_ID BAB80069.1 LENGTH 118 SQ:AASEQ MTRLACSAHNCVNYVNGMCSALTIEVDGESAENKQETCCNTFAPRTFVNAIKSAFNTNYAGTIMQALDSQEDVDHKIKCYAMNCTYNVGMTCTSTDIQVFGPEATTSTSTECETFYKK GT:EXON 1|1-118:0| NREPEAT 1 REPEAT 2|3->31|76->104| SEG 105->114|ttststecet| HM:PFM:NREP 3 HM:PFM:REP 5->42|PF07561|1.2e-12|44.7|38/40|DUF1540| HM:PFM:REP 77->115|PF07561|2.7e-13|48.7|39/40|DUF1540| HM:PFM:REP 27->81|PF10455|7.8e-05|28.3|53/289|BAR_2| OP:NHOMO 15 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111111-1-----111----------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccccccccccccccccccccEEEEcEEcccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccEEEEEEEEcEEccccEEEccEEEEEcccccccccccEEEEEEc //