[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0386
DDBJ      :CPE0386      probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  176/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.190.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->152 3bwgB PDBj 1e-06 26.8 %
:RPS:PDB   13->76 1e2xA PDBj 1e-19 31.2 %
:RPS:PDB   107->231 3ddvB PDBj 8e-04 12.9 %
:RPS:SCOP  13->76 1e2xA1  a.4.5.6 * 1e-19 31.2 %
:RPS:SCOP  107->231 3cnvA1  d.190.1.2 * 1e-05 9.6 %
:HMM:SCOP  10->83 1hw1A1 a.4.5.6 * 1.4e-16 39.2 %
:RPS:PFM   17->76 PF00392 * GntR 4e-12 45.0 %
:HMM:PFM   13->76 PF00392 * GntR 8.3e-20 42.2 64/64  
:BLT:SWISS 14->122 TRER_BACSU 3e-12 34.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80092.1 GT:GENE CPE0386 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(499248..499979) GB:FROM 499248 GB:TO 499979 GB:DIRECTION - GB:GENE CPE0386 GB:PRODUCT probable transcriptional regulator GB:NOTE 243 aa, similar to gpu:AP001515_128 transcriptional regulator (GntR family) from Bacillus halodurans (242 aa); 27.2% identity in 217 aa overlap GntR family GB:PROTEIN_ID BAB80092.1 LENGTH 243 SQ:AASEQ MEILTVNKHKELLYVTVYDKLFKMINEGTFPENSRLPSEPELAKRLGVSRSTLRQALALLQDDGLIKNIRGKGNYIIKENKTDTTGLEKIGHPVYKCLDVETNNIELDFKIDPPSDYYKKILGDSSVATVCIDRWYLDDNLALAYSYTILSIEAISKFNIDLSDKNNLLKFIEEESYKECSKIKSTIKFTTSGNFVTKRHPIPDESQFYLIEEAIYSNSELPVIFNKHYLPMKHSTIKINPMK GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 14->122|TRER_BACSU|3e-12|34.3|108/238| BL:PDB:NREP 1 BL:PDB:REP 12->152|3bwgB|1e-06|26.8|138/225| RP:PDB:NREP 2 RP:PDB:REP 13->76|1e2xA|1e-19|31.2|64/222| RP:PDB:REP 107->231|3ddvB|8e-04|12.9|124/139| RP:PFM:NREP 1 RP:PFM:REP 17->76|PF00392|4e-12|45.0|60/64|GntR| HM:PFM:NREP 1 HM:PFM:REP 13->76|PF00392|8.3e-20|42.2|64/64|GntR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00392|IPR000524| GO:PFM GO:0005622|"GO:intracellular"|PF00392|IPR000524| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00392|IPR000524| RP:SCP:NREP 2 RP:SCP:REP 13->76|1e2xA1|1e-19|31.2|64/73|a.4.5.6| RP:SCP:REP 107->231|3cnvA1|1e-05|9.6|125/156|d.190.1.2| HM:SCP:REP 10->83|1hw1A1|1.4e-16|39.2|74/0|a.4.5.6|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 236 OP:NHOMOORG 178 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------111--1--------1121--------------------------------------------------------------------------------------------------1-----------------------2-22222122122212121--222222211122211111---11111111111111---111----1--1-111---11-1-1----222----111111111111111111111111111-22111222-1---2-----1-2-1-----333-1--------11----1--1-111--1-----------------------1-1111111-113-------------211122-33311--------1-111-1---------------------------------------------------1----111111-----11-1------1----1---------------2--------1------------------------------------------1-----------------------------------2-------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------1----1--1----------------------------11------------------------------------------------------------2---------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------5-----------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 94.7 SQ:SECSTR HHHHTccHHcccHHHHHHHHHHHHHHTTcccTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEETTEEEEEcEcccccccccHHHccEHHcccTTccEEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEETTEEEEEEEEEEEGGGTTTccHHHH#HHcHHHHHHHHHcccEEEEEEEEEEEEccHHHHHHHTccTTcEEEEEEEEEEETTccEEEEEEEEEE############ DISOP:02AL 1-12| PSIPRED ccccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEcccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEEEEEEccccHHHHHHHccccccEEEEEEEEEEccEEEEEEEEEccHHHcccccHHHHccccHHHHHHHHcccEEEEEEEEEEEEEccHHHHHHHcccccccEEEEEEEEEccccEEEEEEEEEEcccEEEEEEEEEc //