[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0392
DDBJ      :CPE0392      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->46 PF07172 * GRP 0.00042 31.4 35/95  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80098.1 GT:GENE CPE0392 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 506672..506824 GB:FROM 506672 GB:TO 506824 GB:DIRECTION + GB:GENE CPE0392 GB:PRODUCT hypothetical protein GB:NOTE 50 aa, no significant homology. GB:PROTEIN_ID BAB80098.1 LENGTH 50 SQ:AASEQ MNKNMEMMKKLIEEKKNKGKNTKANVRAQKTIGFAQGGRKSNNGGGLFDK GT:EXON 1|1-50:0| SEG 1->21|mnknmemmkklieekknkgkn| HM:PFM:NREP 1 HM:PFM:REP 12->46|PF07172|0.00042|31.4|35/95|GRP| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-26, 36-50| PSIPRED ccccHHHHHHHHHHHHccccccccccHHHHHccccccccccccccccccc //