[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0401
DDBJ      :CPE0401      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->104 2ocyA PDBj 2e-05 29.0 %
:HMM:PFM   37->102 PF12325 * TMF_TATA_bd 3.5e-07 26.2 65/121  
:BLT:SWISS 37->96 SGM1_YEAST 3e-05 40.0 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80107.1 GT:GENE CPE0401 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 515887..516204 GB:FROM 515887 GB:TO 516204 GB:DIRECTION + GB:GENE CPE0401 GB:PRODUCT hypothetical protein GB:NOTE 105 aa, no significant homology. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB80107.1 LENGTH 105 SQ:AASEQ MKITDEKVKKNFVIRALKQIGTFFIFTMVFAIVFSFLQPRVYKTHSEYLSIKEKYDNLQKEYDSLNEKISNDTNALNSKKEDLTKSNEDLQNKLNSLNKEIQSLN GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 37->96|SGM1_YEAST|3e-05|40.0|60/707| COIL:NAA 56 COIL:NSEG 1 COIL:REGION 50->105| TM:NTM 1 TM:REGION 20->42| BL:PDB:NREP 1 BL:PDB:REP 43->104|2ocyA|2e-05|29.0|62/146| HM:PFM:NREP 1 HM:PFM:REP 37->102|PF12325|3.5e-07|26.2|65/121|TMF_TATA_bd| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 59.0 SQ:SECSTR ##########################################HHHHHHHHHHHTTHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHH# DISOP:02AL 1-7, 70-94, 100-105| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //