[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0407
DDBJ      :CPE0407      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   68->109 PF05987 * DUF898 5e-04 33.3 %
:HMM:PFM   19->102 PF03595 * C4dic_mal_tran 2.1e-05 22.4 67/287  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80113.1 GT:GENE CPE0407 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 522549..522902 GB:FROM 522549 GB:TO 522902 GB:DIRECTION + GB:GENE CPE0407 GB:PRODUCT hypothetical protein GB:NOTE 117 aa, no significant homology. 2 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80113.1 LENGTH 117 SQ:AASEQ MAYKSSIILNKEKYDSYFDNTFKNSIVHHLKCLLLGILTLGLAYPWIICMKYEATCKHTVICGKRLKFIGNPKELIGHWIFWWILIVITFGLYGLVVKIRFQQWTSANTIFEDVEIK GT:EXON 1|1-117:0| TM:NTM 2 TM:REGION 36->58| TM:REGION 76->98| SEG 30->42|lkclllgiltlgl| RP:PFM:NREP 1 RP:PFM:REP 68->109|PF05987|5e-04|33.3|42/341|DUF898| HM:PFM:NREP 1 HM:PFM:REP 19->102|PF03595|2.1e-05|22.4|67/287|C4dic_mal_tran| OP:NHOMO 22 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------111111----------------------1--1111-1-1----11-------------------------------------------1-----------1-----------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccEEEEHHHccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHEEEEEHHHHHHHHHEccccccc //