[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0424
DDBJ      :CPE0424      conserved hypothetical protein
Swiss-Prot:TRMB_CLOPE   RecName: Full=tRNA (guanine-N(7)-)-methyltransferase;         EC=2.1.1.33;AltName: Full=tRNA(m7G46)-methyltransferase;

Homologs  Archaea  0/68 : Bacteria  340/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->208 2fcaB PDBj 1e-43 43.9 %
:RPS:PDB   19->219 3dxxA PDBj 4e-24 20.1 %
:RPS:SCOP  38->217 1yzhA1  c.66.1.53 * 2e-14 41.0 %
:HMM:SCOP  37->217 2fcaA1 c.66.1.53 * 3.9e-22 24.1 %
:RPS:PFM   29->218 PF02390 * Methyltransf_4 3e-20 31.1 %
:HMM:PFM   27->218 PF02390 * Methyltransf_4 6.1e-42 31.4 185/197  
:BLT:SWISS 1->219 TRMB_CLOPE e-131 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80130.1 GT:GENE CPE0424 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 544692..545351 GB:FROM 544692 GB:TO 545351 GB:DIRECTION + GB:GENE CPE0424 GB:PRODUCT conserved hypothetical protein GB:NOTE 219 aa, similar to pir:B69997 conserved hypothetical protein ytmQ from Bacillus subtilis (213 aa); 43.8% identity in 208 aa overlap GB:PROTEIN_ID BAB80130.1 LENGTH 219 SQ:AASEQ MRMRRKPWARPELEACDFFVANPKENKGNWKNTFKNTENPIYLELGCGKGTFMAVHGSDNPNINYIAIDIKDEVLVLAKRSIEKAYEEKNKALDNVKLMPQEIALIDTILDSNDKIERIYINFCNPWPKDRHKKRRLTHTRQLTKYRDFLVDGGEIHFKTDDDELFEESLEYFKECNFEITYITRDLHNSGYEYNVVTEHEEMFSKQGIKIKFLIAKKL GT:EXON 1|1-219:0| SW:ID TRMB_CLOPE SW:DE RecName: Full=tRNA (guanine-N(7)-)-methyltransferase; EC=2.1.1.33;AltName: Full=tRNA(m7G46)-methyltransferase; SW:GN Name=trmB; OrderedLocusNames=CPE0424; SW:KW Complete proteome; Methyltransferase; S-adenosyl-L-methionine;Transferase; tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->219|TRMB_CLOPE|e-131|100.0|219/219| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| BL:PDB:NREP 1 BL:PDB:REP 14->208|2fcaB|1e-43|43.9|187/203| RP:PDB:NREP 1 RP:PDB:REP 19->219|3dxxA|4e-24|20.1|194/208| RP:PFM:NREP 1 RP:PFM:REP 29->218|PF02390|3e-20|31.1|183/197|Methyltransf_4| HM:PFM:NREP 1 HM:PFM:REP 27->218|PF02390|6.1e-42|31.4|185/197|Methyltransf_4| GO:PFM:NREP 2 GO:PFM GO:0006400|"GO:tRNA modification"|PF02390|IPR003358| GO:PFM GO:0008176|"GO:tRNA (guanine-N7-)-methyltransferase activity"|PF02390|IPR003358| RP:SCP:NREP 1 RP:SCP:REP 38->217|1yzhA1|2e-14|41.0|173/204|c.66.1.53| HM:SCP:REP 37->217|2fcaA1|3.9e-22|24.1|174/0|c.66.1.53|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 349 OP:NHOMOORG 347 OP:PATTERN -------------------------------------------------------------------- --------------1--11-11--1-1111111111------------------------------1-----------1--111----1111-111---111111111-11------111---------------------------1--1111111-1-----11--1111111---1111------11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111--111-11----1-------111------1-------------------------------------------------------------1-1------------------111------------1-11-1-11-11-1-1------------------------------------1-1--------------------------111111111----1--------------111111111---------1------------------1-------------------------------------------1-----------------------------------------------1----------------------------111111111111---1-----------1--111---1----1-----1--------------------------1---11-1-1-11---------11------------------111111--------1-1----1-1111111111111111111-1-111-11111- -------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------3--------------1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 93.6 SQ:SECSTR #############TTTTTHccccccccccHHHHHcc#cccEEEEEccTTcHHHHHHHHHcTTcEEEEEcccHHHHHHHHHHHHHTTcccEEEcccEEEEcccHHHHHHHHccTTcEEEEEEEcccccccGGGGGGccccHHHHHHHHHHEEEEEEEEEEEccHHHHHHHHHHHHTcTTEEEccTTcccccccTTccccTTccTTcTTccccEEEEEEEc DISOP:02AL 218-220| PSIPRED cccccccccHHHHHcccccccccccccccHHHHcccccccEEEEEEcccHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccccEEEEEccccccccHHHHHccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHccccEEEEEEEEc //