[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0428
DDBJ      :CPE0428      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80134.1 GT:GENE CPE0428 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 549541..549696 GB:FROM 549541 GB:TO 549696 GB:DIRECTION + GB:GENE CPE0428 GB:PRODUCT hypothetical protein GB:NOTE 51 aa, no significant homology. GB:PROTEIN_ID BAB80134.1 LENGTH 51 SQ:AASEQ MPKDSQPDNKVARMEKCNFQTPITSEEGKNHNRTAKKHSVKREGFQSPHIN GT:EXON 1|1-51:0| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111-111----1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11, 24-51| PSIPRED cccccccccHHHHHHHccccccccccccccccccHHHHHHHHccccccccc //