[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0434
DDBJ      :CPE0434      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->162 1i21B PDBj 5e-05 31.6 %
:RPS:PDB   75->161 3efaA PDBj 6e-09 16.0 %
:RPS:SCOP  34->160 2fiwA1  d.108.1.1 * 2e-09 21.2 %
:HMM:SCOP  29->161 1xebA_ d.108.1.1 * 6e-14 23.2 %
:RPS:PFM   84->159 PF00583 * Acetyltransf_1 4e-05 33.8 %
:HMM:PFM   83->160 PF00583 * Acetyltransf_1 2.1e-12 35.1 77/83  
:HMM:PFM   11->76 PF12161 * HsdM_N 0.001 20.4 54/132  
:BLT:SWISS 106->161 MAK3_XENLA 1e-04 39.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80140.1 GT:GENE CPE0434 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 555174..555662 GB:FROM 555174 GB:TO 555662 GB:DIRECTION + GB:GENE CPE0434 GB:PRODUCT hypothetical protein GB:NOTE 162 aa, no significant homology. GB:PROTEIN_ID BAB80140.1 LENGTH 162 SQ:AASEQ MESKENSKKSSEAKNKLEKIYSTSLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLKGNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATRINLEAYNDKSIVLFENLGFERS GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 106->161|MAK3_XENLA|1e-04|39.3|56/273| SEG 2->19|eskenskksseaknklek| BL:PDB:NREP 1 BL:PDB:REP 66->162|1i21B|5e-05|31.6|95/152| RP:PDB:NREP 1 RP:PDB:REP 75->161|3efaA|6e-09|16.0|81/143| RP:PFM:NREP 1 RP:PFM:REP 84->159|PF00583|4e-05|33.8|74/80|Acetyltransf_1| HM:PFM:NREP 2 HM:PFM:REP 83->160|PF00583|2.1e-12|35.1|77/83|Acetyltransf_1| HM:PFM:REP 11->76|PF12161|0.001|20.4|54/132|HsdM_N| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 34->160|2fiwA1|2e-09|21.2|118/156|d.108.1.1| HM:SCP:REP 29->161|1xebA_|6e-14|23.2|125/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 11 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11----------------------------------------------------------------------------------------------------------------222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 87.0 SQ:SECSTR #####################cccEEEEcEEEEccGGGHHHHHHTTGGGccccHHHHHHHHHTcTTccGGGEEEccEEEEEEETTEEEEEEEEEEEcTTccTTEEEEEEEEcGGGTTccHHHHHHHHHHHHHHHcTTccEEEEEETEGGGHHHHHHTTcEEc DISOP:02AL 1-19| PSIPRED cccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHccccEEEEEEEcccEEEEEEEEEccccccEEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHcccccc //