[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0446
DDBJ      :CPE0446      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   164->201 PF01005 * Flavi_NS2A 0.00047 23.7 38/216  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80152.1 GT:GENE CPE0446 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 565475..566116 GB:FROM 565475 GB:TO 566116 GB:DIRECTION + GB:GENE CPE0446 GB:PRODUCT hypothetical protein GB:NOTE 213 aa, no significant homology. Putative N-terminal signal sequence and 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80152.1 LENGTH 213 SQ:AASEQ MKNLIIKDLKNIRVIFIFYILTMTFGYSPFFIDLPKDRYDFLINSVFIYFTLLASMISVNFIIAKNTNKGAMTNKLLRSLPIDARSVVGTSFILPILIFLIFSLPNILAGMGVSFMLGEKIIVNTFNLLLTFIIFYIYASITFSMAIIYPESSVVSYLRSVPLFILIIGLALVEKFMKNINYDVSNILNSLPLVVLILAVISIFILIVFTSFP GT:EXON 1|1-213:0| TM:NTM 6 TM:REGION 9->31| TM:REGION 42->64| TM:REGION 90->112| TM:REGION 126->148| TM:REGION 158->180| TM:REGION 189->211| SEG 91->108|sfilpiliflifslpnil| HM:PFM:NREP 1 HM:PFM:REP 164->201|PF01005|0.00047|23.7|38/216|Flavi_NS2A| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //