[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0451
DDBJ      :CPE0451      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  228/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->126 2p25A PDBj 5e-28 46.7 %
:RPS:PDB   5->126 2a4wA PDBj 2e-22 15.6 %
:RPS:SCOP  5->126 1f9zA  d.32.1.1 * 2e-22 23.0 %
:HMM:SCOP  1->127 1sp8A2 d.32.1.3 * 2.4e-33 31.5 %
:RPS:PFM   5->123 PF00903 * Glyoxalase 3e-09 27.7 %
:HMM:PFM   5->124 PF00903 * Glyoxalase 1.5e-23 30.0 120/128  
:BLT:SWISS 1->126 YWKD_BACSU 5e-43 64.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80157.1 GT:GENE CPE0451 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 569990..570382 GB:FROM 569990 GB:TO 570382 GB:DIRECTION + GB:GENE CPE0451 GB:PRODUCT conserved hypothetical protein GB:NOTE 130 aa, similar to sp:YWKD_BACSU HYPOTHETICAL 14.8 KDA PROTEIN IN TDK-PRFA INTERGENIC REGION from Bacillus subtilis (128 aa); 64.3% identity in 126 aa overlap GB:PROTEIN_ID BAB80157.1 LENGTH 130 SQ:AASEQ MNLKKIHHVAIIASDYKKSKDFYVNLLGLKIIREVYREERDSYKLDLEIGDSQIELFSFKNPPKRPSYPEACGLRHLAFEVENIEKQVRELKEKGIKVEEIRIDEFTGRKFTFFSDPDDLPIELYEITCN GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|YWKD_BACSU|5e-43|64.3|126/128| BL:PDB:NREP 1 BL:PDB:REP 4->126|2p25A|5e-28|46.7|122/124| RP:PDB:NREP 1 RP:PDB:REP 5->126|2a4wA|2e-22|15.6|122/128| RP:PFM:NREP 1 RP:PFM:REP 5->123|PF00903|3e-09|27.7|119/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 5->124|PF00903|1.5e-23|30.0|120/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 5->126|1f9zA|2e-22|23.0|122/128|d.32.1.1| HM:SCP:REP 1->127|1sp8A2|2.4e-33|31.5|127/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 236 OP:NHOMOORG 232 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1--1---------------1---111------------------------------------------111--------------111-----------------------111111111-111111--11-1111231--------------------------------1-----------------11---1111111111111-----------11111111111111111111111-1112-------1-1-----111-1-----1------1-----111--------------------------------------------------1-------1--------1---------------------11------------------------------------------------------------------------------1-----1-----------1-------------------------------------------------------------------------11-1-11-111-1111-1-111--1---1--------------11111111111111111-111111111111111111111111--1111111111111111111111111--111111111111---------------1-11111-1--------1----------11-------------1----------------111111-11111111111111----------------------------------------------------1-------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1----1------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 130 STR:RPRED 100.0 SQ:SECSTR TTTccccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEcGGGcEEEEHHHHHTTcTTccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEEcTTcEEEEEEEcTTccEEEEEEcccc DISOP:02AL 130-131| PSIPRED ccccEEEEEEEEcccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEccccEEEEEEcccccccccccccccEEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEEEcc //