[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0515
DDBJ      :CPE0515      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->126 PF12389 * Peptidase_M73 3e-06 33.6 %
:HMM:PFM   2->126 PF12389 * Peptidase_M73 5.4e-09 27.6 116/199  
:BLT:SWISS 85->210 SECA_ALCBS 8e-04 28.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80221.1 GT:GENE CPE0515 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 641482..642117 GB:FROM 641482 GB:TO 642117 GB:DIRECTION + GB:GENE CPE0515 GB:PRODUCT hypothetical protein GB:NOTE 211 aa, some similarity to N-terminal of gpu:AP001514_135 spore coat-associated protein from Bacillus halodurans (210 aa); 27.2% identity in 103 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB80221.1 LENGTH 211 SQ:AASEQ MSKKKIIGLCIAGVLAVGSIGGSLAWFTSSDSVTNPFSTASTDNPSDPNSGIKIHEDFNKEDADNTLPGDTVTKQVNVINKATYDQLIRVKIKKVWKDAKGEEKSDLDTKNINLNFENNLTDSNKPEEGKWIEGSDGYYYYNGIVNPDGQTANLLESVTLSKDTTNEFKGLKFDVVVDSEGVQAANGAVNDSWKDAPQVIKKLGAGTNAHK GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 85->210|SECA_ALCBS|8e-04|28.2|117/100| TM:NTM 1 TM:REGION 6->28| RP:PFM:NREP 1 RP:PFM:REP 1->126|PF12389|3e-06|33.6|116/186|Peptidase_M73| HM:PFM:NREP 1 HM:PFM:REP 2->126|PF12389|5.4e-09|27.6|116/199|Peptidase_M73| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------122----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 207-211| PSIPRED ccHHHHHHHHHHHHHHHHHHHcEEEEEccccEEEcccccccccccccccEEEEEccccccccccccccccEEEEEEEEEEccEEccEEEEEEEEEEEEccccccccccccEEEEEEHHHHHHccccccccEEEEcccEEEEEEEEccccHHHHHHHHEEEccccHHHHcccEEEEEEEccccccccHHHHHHcccHHHHHHHHcccccccc //