[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0518
DDBJ      :CPE0518      two-component response regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  313/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:238 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->126 2j8eA PDBj 4e-09 30.5 %
:BLT:PDB   151->231 3d6wB PDBj 1e-06 27.2 %
:RPS:PDB   1->61 2dvyD PDBj 3e-04 7.5 %
:RPS:PDB   34->133 3cwoX PDBj 4e-15 23.5 %
:RPS:PDB   132->231 3d6wA PDBj 2e-18 23.2 %
:RPS:SCOP  2->126 1a2oA1  c.23.1.1 * 2e-15 15.5 %
:HMM:SCOP  1->124 1s8nA_ c.23.1.1 * 5e-22 30.4 %
:RPS:PFM   4->115 PF00072 * Response_reg 1e-09 36.5 %
:RPS:PFM   145->228 PF04397 * LytTR 3e-11 38.1 %
:HMM:PFM   141->231 PF04397 * LytTR 1.6e-26 35.2 91/98  
:HMM:PFM   4->118 PF00072 * Response_reg 2.3e-18 30.6 108/112  
:BLT:SWISS 1->231 LYTT_BACAN 4e-21 28.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80224.1 GT:GENE CPE0518 GT:PRODUCT two-component response regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 644991..645707 GB:FROM 644991 GB:TO 645707 GB:DIRECTION + GB:GENE CPE0518 GB:PRODUCT two-component response regulator GB:NOTE 238 aa, similar to pir:S60139 virR protein from Clostridium perfringens (252 aa); 31.9% identity in 238 aa overlap GB:PROTEIN_ID BAB80224.1 LENGTH 238 SQ:AASEQ MLNIAICDDEKVQRNILKDMLYKICNKNNMDVIIDEFCSGVDLLNVYKRNTKKYSIVFCDILMDEMNGIELLRKIGELDAFIQAILITGSEEYVFQGYDVGALNYLMKPVSFEKLEKEFLRAIKSLNFTSPSRYAININGKTNFIDLSEVLFFEVNNKTITANLEKESIDFNMKIATLEEELKSRNFLRCHRSYLVNISHIDSILQNKIILKNSVEIPVGRVYKKELKTFLMNRIGDM GT:EXON 1|1-238:0| BL:SWS:NREP 1 BL:SWS:REP 1->231|LYTT_BACAN|4e-21|28.9|225/246| BL:PDB:NREP 2 BL:PDB:REP 2->126|2j8eA|4e-09|30.5|118/128| BL:PDB:REP 151->231|3d6wB|1e-06|27.2|81/107| RP:PDB:NREP 3 RP:PDB:REP 1->61|2dvyD|3e-04|7.5|53/214| RP:PDB:REP 34->133|3cwoX|4e-15|23.5|98/236| RP:PDB:REP 132->231|3d6wA|2e-18|23.2|99/107| RP:PFM:NREP 2 RP:PFM:REP 4->115|PF00072|1e-09|36.5|104/111|Response_reg| RP:PFM:REP 145->228|PF04397|3e-11|38.1|84/97|LytTR| HM:PFM:NREP 2 HM:PFM:REP 141->231|PF04397|1.6e-26|35.2|91/98|LytTR| HM:PFM:REP 4->118|PF00072|2.3e-18|30.6|108/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 2->126|1a2oA1|2e-15|15.5|116/140|c.23.1.1| HM:SCP:REP 1->124|1s8nA_|5e-22|30.4|115/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 529 OP:NHOMOORG 316 OP:PATTERN -------------------------------------------------------------------- -36-1--------------------1-----------111--------1---111--1--11---221-111------1131----222251-5------1D343K2D3B-----------------------------------------------------------------------------------1222221121212111--1122211-11311-2----32-1111111-1111111111112---11----11111111-1-11---2221121111-111------1--------------11111111--33444444554-414722122241--1-5B124671-22313112--1-12------------------------------------------------11--------1----------------------------------------------------------------1------------1--------------1--1--------------111--1-111111-----------111----------1---------------1-1---3-------------------1------211-131----1111111-111111--113------1------1112--1111-1-1-11-111111-1-11-1-111111111111-----------------111-1111--211111111111---1----------11-----------------------1-2--11111---11----1111----------111211111--111111-1-------------22------------1-1-------------------------11-11-1----2- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 97.1 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHTcTHHHccEEEEEccccccTTHHHHHHHTcccccEEEEcccTTccHHHHHHHHHHHcccccEEEEccTHHHHHHHHHTTccEEEEcHHHHHcTHHHHHHHHHHTGGccccEEEEEccccEEEEEGGGGEEEEEETTEEEEEEcccEEEEcccHHHHHHHccTTTEEEEETTEEEEGGGEEEEcccEEEETTccEEEEcTTTHHHHHHHH####### DISOP:02AL 132-133| PSIPRED ccEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEcccEEEEcHHHEEEEEEEccEEEEEEccEEEEEEccHHHHHHHHcccccEEEEHHHHHHHHHHHHHcccEEEEEcccEEEEEHHHHHHHHHHHHHHHccc //