[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0521
DDBJ      :CPE0521      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  264/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.112.1
:148 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->146 3bjvA PDBj 5e-16 26.6 %
:RPS:PDB   7->147 1a3aA PDBj 1e-28 29.0 %
:RPS:SCOP  7->147 1a3aA  d.112.1.1 * 8e-29 29.0 %
:HMM:SCOP  3->149 1a6jA_ d.112.1.1 * 7.4e-35 34.9 %
:RPS:PFM   9->146 PF00359 * PTS_EIIA_2 1e-16 37.8 %
:HMM:PFM   8->147 PF00359 * PTS_EIIA_2 4.6e-36 38.7 137/142  
:BLT:SWISS 5->146 ULAC_SALTI 8e-22 33.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80227.1 GT:GENE CPE0521 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 648362..648808 GB:FROM 648362 GB:TO 648808 GB:DIRECTION + GB:GENE CPE0521 GB:PRODUCT conserved hypothetical protein GB:NOTE 148 aa, similar to C-terminal of gpu:AP001507_220 BH0220 gene product from Bacillus halodurans (701 aa); 31.7% identity in 142 aa overlap GB:PROTEIN_ID BAB80227.1 LENGTH 148 SQ:AASEQ MVNFIRDLLNENNIILKAKAFNKEEAVRLAAEPLLKDGSITDEYVKDILEKINDLGPYMAIMPGVVIAHSRPGDYVFKECISMLTLENPVEFGHEDNDPIEIIFVIGAKENTGHLDALQDLARVLINEDSVNKIKNAQNKKEIMELFM GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 5->146|ULAC_SALTI|8e-22|33.1|142/154| BL:PDB:NREP 1 BL:PDB:REP 2->146|3bjvA|5e-16|26.6|143/156| RP:PDB:NREP 1 RP:PDB:REP 7->147|1a3aA|1e-28|29.0|138/145| RP:PFM:NREP 1 RP:PFM:REP 9->146|PF00359|1e-16|37.8|135/142|PTS_EIIA_2| HM:PFM:NREP 1 HM:PFM:REP 8->147|PF00359|4.6e-36|38.7|137/142|PTS_EIIA_2| GO:PFM:NREP 3 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00359|IPR002178| GO:PFM GO:0006810|"GO:transport"|PF00359|IPR002178| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00359|IPR002178| RP:SCP:NREP 1 RP:SCP:REP 7->147|1a3aA|8e-29|29.0|138/145|d.112.1.1| HM:SCP:REP 3->149|1a6jA_|7.4e-35|34.9|146/150|d.112.1.1|1/1|Phoshotransferase/anion transport protein| OP:NHOMO 585 OP:NHOMOORG 266 OP:PATTERN -------------------------------------------------------------------- ------1-111--------------------------------------111--11-------1----1---------2-----------------------------------------------------------------------------------------------------------------11-------11-----1532121---21-14--7678751--33323323333333-----11-1231-21243--241-1-12-112322222112333333332322222222222222122---222311-133333333323-5--1121-1--111---------1---33211-2--------1111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------1-----------------------------111411212-3223322122-2232222223233333333555331114444454544444444222122222-222222222222------------------1111121----1--2---------------------------------------144111111-2-22-----------------2---------------------1-1-212--111-22112---------------- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 146 STR:RPRED 98.6 SQ:SECSTR #ccHHHccccGGGEEcccccccHHHHHHHHHHHHHHTTcccTHHHHHHHHHHHHcccEEcEETTEEcccccGGGGccccEEEEEEEEEEEEccccTTcEEEEEEEEEccTTTHHHHHHHHHHHHTccHHHHHHHHHcccHHHHHHHT# DISOP:02AL 148-149| PSIPRED cccHHHHHccHHHEEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccEEcccccccccccHHHHccccEEEEEEEccccccccccccEEEEEEEEEEcccHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHc //