[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0524
DDBJ      :CPE0524      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  325/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:264 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->264 1ymqA PDBj 5e-27 31.0 %
:RPS:PDB   5->258 3dnpA PDBj 5e-21 19.4 %
:RPS:SCOP  7->264 1ymqA1  c.108.1.10 * 3e-40 28.0 %
:HMM:SCOP  7->265 2b30A1 c.108.1.10 * 2e-53 32.8 %
:RPS:PFM   11->258 PF08282 * Hydrolase_3 3e-20 32.1 %
:HMM:PFM   8->258 PF08282 * Hydrolase_3 7.1e-66 34.0 247/254  
:BLT:SWISS 7->264 YKRA_BACSU 2e-23 30.6 %
:PROS 212->234|PS01229|COF_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80230.1 GT:GENE CPE0524 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 650923..651717 GB:FROM 650923 GB:TO 651717 GB:DIRECTION + GB:GENE CPE0524 GB:PRODUCT conserved hypothetical protein GB:NOTE 264 aa, similar to gpu:AP001516_88 BH2659 gene product from Bacillus halodurans (257 aa); 29.1% identity in 258 aa overlap GB:PROTEIN_ID BAB80230.1 LENGTH 264 SQ:AASEQ MKNLKGIVFFDVDGTLIDCGKGLYKPSNKTKEAIKKLKENGYLTILATGRPMSFVDDGLKELELDGYIASNGTYIELNNEVILNDDIKLEKLKEIMDYCVEHNINFILEGQKTSYVLNNDVAKKMVENFSLPEESFTGDWTEEELSANKLVIVDNNKDDFKDIFERFKDEFVFMQHPGHSSYDMYRRGCTKAHGIEHLIKELGLSDKDTYAFGDGENDIEMFQRVKYGIAMGDAHETLIPHAYKQTENVPNEGIYKALLELGLI GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 7->264|YKRA_BACSU|2e-23|30.6|248/257| PROS 212->234|PS01229|COF_2|PDOC00944| BL:PDB:NREP 1 BL:PDB:REP 8->264|1ymqA|5e-27|31.0|248/260| RP:PDB:NREP 1 RP:PDB:REP 5->258|3dnpA|5e-21|19.4|248/268| RP:PFM:NREP 1 RP:PFM:REP 11->258|PF08282|3e-20|32.1|243/253|Hydrolase_3| HM:PFM:NREP 1 HM:PFM:REP 8->258|PF08282|7.1e-66|34.0|247/254|Hydrolase_3| RP:SCP:NREP 1 RP:SCP:REP 7->264|1ymqA1|3e-40|28.0|254/260|c.108.1.10| HM:SCP:REP 7->265|2b30A1|2e-53|32.8|256/0|c.108.1.10|1/1|HAD-like| OP:NHOMO 808 OP:NHOMOORG 330 OP:PATTERN -------------------------------------------------------------------- -------21111-----------------------------------------1-11-----11--------111---1-11------1122-1------1--2---1---------------------------------111-----------------------------------------------2134444445435444443433344453122424AABA98222222222422222223334466212213416221111222-336678884434555555546655663444444443443444444333B12165333333343416--4665-1--1-24------------1--1122-----------------------------------------1----------------------------------------------1------------------------------------------------------------------------------------------------1111111---------------------------------------------------------------------------1---------------------2----------1211-311111111111-1111111111111111112221--1--11-----1--1111-1122-1111--211111111111------------------3332221----211111111-1111-------------------111111111----1------1311-1---------------2---------1-----12----1-11123-1222314-21----1111--11---- 12------2-----------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 100.0 SQ:SECSTR HHHcccEEEEccccccccTTcTTccccHHHHHHHHHHHHTTcEEEEcccccHHHHHHHHHHTTccccEEEGTEEEccTTcccEEccccHHHHHHHHHHHHTcccEEEEEccccEEEcccccccHHHHHcccccccHHHHHHccccccEEEEEccGGGHHHHHHHHHHHcTTEEEEEEETTEEEEEETTccHHHHHHHHHHHTTcccGGEEEEEccGGGHHHHHHccEEEETTTccHHHHHHccEEcccTTTTHHHHHHHHTHHT PSIPRED ccccEEEEEEEccccccccccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEEccEEEEEccEEEEEccccHHHHHHHHHHHHHcccEEEEEEccEEEEEccHHHHHHHHHcccccccccccccccccccEEEEEEcccHHHHHHHHHHHHcccEEEEEccccEEEEEcccccHHHHHHHHHHHHcccHHHEEEEEccccHHHHHHHcccEEEEccccHHHHHHHHEccccccccHHHHHHHHcccc //