[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0529
DDBJ      :CPE0529      probable malate permease
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:349 amino acids
:PSIPRED
:HMM:PFM   14->157 PF03547 * Mem_trans 1.5e-20 20.1 144/385  
:HMM:PFM   165->336 PF03547 * Mem_trans 5.5e-15 23.0 148/385  
:BLT:SWISS 36->280 Y1031_METJA 4e-09 23.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80235.1 GT:GENE CPE0529 GT:PRODUCT probable malate permease GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 658398..659447 GB:FROM 658398 GB:TO 659447 GB:DIRECTION + GB:GENE CPE0529 GB:PRODUCT probable malate permease GB:NOTE 349 aa, similar to gp:AF132735_8 malate permease from Clostridium cellulovorans (290 aa); 24% identity in 254 aa overlap. Putative N-terminal signal sequence and 7 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80235.1 LENGTH 349 SQ:AASEQ MLEIIQKTLTDNAIIGAIFSSIAIIFLGFYIRKRNILTGAASKILTKVVLTVAIPALAFTSFMKDINQKELHEGINILIWGFVIYILLIVLTKFIFARVKGDKQDVFRVLTIFGSTTFFGVPIVKAVYGSVGAMYSSIFNIAYRVFLYSYGYIKMSGVKMDKENLKKNLKEMLLNPVIIATFLGLFIWLFQGMLPQVQIGDKSYAFLRIDQTLPWLYKPLTYLDKLCSPLAWLAIGITLAEVPFKQAVGQKEPWVYSLIKIILVPVINLGLLVVLNKTGILPVSFEGMATTVIMLATPTATVAAAYAISFDKEALLTSNCSLLSTVVAVVAMPFWIVILQIIKNIGLFA GT:EXON 1|1-349:0| BL:SWS:NREP 1 BL:SWS:REP 36->280|Y1031_METJA|4e-09|23.6|220/308| TM:NTM 10 TM:REGION 6->28| TM:REGION 39->61| TM:REGION 75->97| TM:REGION 105->127| TM:REGION 131->153| TM:REGION 178->200| TM:REGION 215->237| TM:REGION 254->276| TM:REGION 285->307| TM:REGION 320->342| SEG 13->29|aiigaifssiaiiflgf| SEG 159->175|kmdkenlkknlkemlln| SEG 296->307|atptatvaaaya| HM:PFM:NREP 2 HM:PFM:REP 14->157|PF03547|1.5e-20|20.1|144/385|Mem_trans| HM:PFM:REP 165->336|PF03547|5.5e-15|23.0|148/385|Mem_trans| OP:NHOMO 48 OP:NHOMOORG 42 OP:PATTERN ---------------------------------------------1---------------------- ---------------------------------------------------------------------------111--21-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1----22-----1---1-----------1-----------------------------------1112-1111111-1--122-111------1---------1-1-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1--1------11------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHEEcccccccHHHHHHHHHHccHHHHHHHHHHHHHcccccccEEEEcccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //