[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0561
DDBJ      :CPE0561      PTS system
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  272/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.95.1
:473 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->80 3bp8C PDBj 2e-15 27.8 %
:RPS:SCOP  8->80 3bp8C1  d.95.1.1 * 8e-16 27.8 %
:HMM:SCOP  6->83 1o2fB_ d.95.1.1 * 3.1e-20 45.5 %
:RPS:PFM   8->42 PF00367 * PTS_EIIB 4e-10 60.0 %
:RPS:PFM   117->404 PF02378 * PTS_EIIC 2e-05 30.8 %
:HMM:PFM   111->407 PF02378 * PTS_EIIC 3.3e-36 22.7 291/321  
:HMM:PFM   8->42 PF00367 * PTS_EIIB 4.4e-16 57.1 35/35  
:HMM:PFM   32->70 PF06805 * Lambda_tail_I 0.00016 27.0 37/194  
:BLT:SWISS 1->433 PTTBC_ECOLI e-111 48.0 %
:PROS 20->37|PS01035|PTS_EIIB_TYPE_1_CYS
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80267.1 GT:GENE CPE0561 GT:PRODUCT PTS system GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 696091..697512 GB:FROM 696091 GB:TO 697512 GB:DIRECTION + GB:GENE CPE0561 GB:PRODUCT PTS system GB:NOTE 473 aa, similar to gpu:AE004175_1 PTS system, trehalose-specific IIBC component from Vibrio cholerae (478 aa); 52.9% identity in 367 aa overlap. 9 putative transmembrane regions were found by PSORT. trehalose-specific IIBC component GB:PROTEIN_ID BAB80267.1 LENGTH 473 SQ:AASEQ MSKFEKDAKLLTEYIGGKENVAAVTHCATRMRFVLNDTSKADVEKIKAIPCVKGTFTQAGQFQVIIGPEVATFYNDFVGQTGVSGESKEEVKKAAKKNMNIVQRAVAGLAEIFAPLIPAIIVGGLILGFRNVIGDMKLFEDGTKSLVEISQFWAGTHSFLWLIGEAIFHFLPVGVVWSIAKKMGADQMLGIVIGITLVSPQLLNAYSAGNGAAAPVWDFGFAQVPMIGYQAQVLPAIMVGFTFVYLERLFKKITPGPIQMIIVPFFSVIPTVLLAHTVLGPIGWKIGSVISGVIVAGLTSSFGWLFAGIFGMIYAPLVITGLHHTLLPVDLQLISDIGGTFLWPIIALSNIAQASAVLAMIYVNRKDEDEKQISIPACISGYLGVTEPAMFGVNLKYLYPFIASMIGAGVAGMFSMAMGCMANSVGVGGLPAILSMQSSSMLMYLVAMGIAIVVPFVLTIVFSKTKLANMASK GT:EXON 1|1-473:0| BL:SWS:NREP 1 BL:SWS:REP 1->433|PTTBC_ECOLI|e-111|48.0|429/473| PROS 20->37|PS01035|PTS_EIIB_TYPE_1_CYS|PDOC00795| TM:NTM 9 TM:REGION 105->127| TM:REGION 150->172| TM:REGION 183->205| TM:REGION 223->245| TM:REGION 256->278| TM:REGION 292->314| TM:REGION 342->363| TM:REGION 406->428| TM:REGION 442->464| SEG 82->97|gvsgeskeevkkaakk| SEG 434->445|lsmqsssmlmyl| RP:PDB:NREP 1 RP:PDB:REP 8->80|3bp8C|2e-15|27.8|72/75| RP:PFM:NREP 2 RP:PFM:REP 8->42|PF00367|4e-10|60.0|35/35|PTS_EIIB| RP:PFM:REP 117->404|PF02378|2e-05|30.8|263/313|PTS_EIIC| HM:PFM:NREP 3 HM:PFM:REP 111->407|PF02378|3.3e-36|22.7|291/321|PTS_EIIC| HM:PFM:REP 8->42|PF00367|4.4e-16|57.1|35/35|PTS_EIIB| HM:PFM:REP 32->70|PF06805|0.00016|27.0|37/194|Lambda_tail_I| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF02378|IPR003352| GO:PFM GO:0008982|"GO:protein-N(PI)-phosphohistidine-sugar phosphotransferase activity"|PF02378|IPR003352| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF02378|IPR003352| GO:PFM GO:0016020|"GO:membrane"|PF02378|IPR003352| RP:SCP:NREP 1 RP:SCP:REP 8->80|3bp8C1|8e-16|27.8|72/75|d.95.1.1| HM:SCP:REP 6->83|1o2fB_|3.1e-20|45.5|77/0|d.95.1.1|1/1|Glucose permease domain IIB| OP:NHOMO 821 OP:NHOMOORG 273 OP:PATTERN -------------------------------------------------------------------- -----211224-4----------------------------------------11--------2-------1---1--2---------------------------------------------------------------------------------------------------------------1-24333333232332323557775432222-145255626--2222222232222223112467--54-1515BC--6622443232344443223333333333332333333333333333442214443---294445435435-8---222---1----------------1-----3---------------------------------------1-----------------------------------------------------------------------------------------------------------------1----------1------------------1-------------------------------------------------------------------------324-------2--------------------------------3663-724333445444-344444244434344444457588443232222222222122253223333--611111111111------------------111322-----1--1-----------------1-1-------------------1-112222212111-----------------3---------------------9---1-------222------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 16.1 SQ:SECSTR ###ccccHHHHHHHTTcTTTEEEEccccccEEEEEccGGGccHHHHHHHTcc#cEEEETTEEEEcccTTHHHHHHHHHHH######################################################################################################################################################################################################################################################################################################################################################################################################### DISOP:02AL 78-103, 470-473| PSIPRED ccHHHHHHHHHHHHcccHHHHHHHHcccEEEEEEEEcHHHccHHHHHHccccEEEEEEccEEEEEEcccHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //