[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0578
DDBJ      :CPE0578      probable ABC transporter
Swiss-Prot:             

Homologs  Archaea  37/68 : Bacteria  576/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->247 2r6gG PDBj 4e-20 27.1 %
:RPS:PDB   133->170 3dhwA PDBj 8e-11 31.6 %
:RPS:SCOP  1->247 2r6gG1  f.58.1.1 * 2e-31 22.4 %
:RPS:PFM   97->182 PF00528 * BPD_transp_1 5e-08 33.7 %
:HMM:PFM   58->233 PF00528 * BPD_transp_1 2.7e-21 16.9 166/185  
:BLT:SWISS 1->247 YURM_BACSU 6e-46 35.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80284.1 GT:GENE CPE0578 GT:PRODUCT probable ABC transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 719139..719882 GB:FROM 719139 GB:TO 719882 GB:DIRECTION + GB:GENE CPE0578 GB:PRODUCT probable ABC transporter GB:NOTE 247 aa, similar to pir:T35672 probable transmembrane transport protein from Streptomyces coelicolor (302 aa); 37% identity in 246 aa overlap. 5 putative transmembrane regions were found by PSORT. permease GB:PROTEIN_ID BAB80284.1 LENGTH 247 SQ:AASEQ MSSFKTTKEFYASPWALPKSFGFANYMTAFTEANMGAYFFNSILVTIIAMVLSLCLSVPASYVLARQKFFGCSFIKNLFMAGLFIQPVYIIVPLFTILEKMKLLNNLFALALVYAVLSLPFSIYIMSGFMKGIAKDYEEAAMIDGCTNLQILTKIVVPLAKPGIITIMIFNFMNYWNEYAMAMTFITDADKKTLPVGLQNLMEVQKFATDWGALFAGLVIVMVPTMVIYSLVHKKLTEGVNIGGVKG GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 1->247|YURM_BACSU|6e-46|35.2|244/300| TM:NTM 5 TM:REGION 40->62| TM:REGION 75->97| TM:REGION 108->130| TM:REGION 152->173| TM:REGION 206->228| BL:PDB:NREP 1 BL:PDB:REP 38->247|2r6gG|4e-20|27.1|207/284| RP:PDB:NREP 1 RP:PDB:REP 133->170|3dhwA|8e-11|31.6|38/203| RP:PFM:NREP 1 RP:PFM:REP 97->182|PF00528|5e-08|33.7|86/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 58->233|PF00528|2.7e-21|16.9|166/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 1->247|2r6gG1|2e-31|22.4|245/284|f.58.1.1| OP:NHOMO 3498 OP:NHOMOORG 617 OP:PATTERN 33--421145454541812221-171151-3-----------------------3453111532---- ---1o213445-1123344-423349444443255514575227P*b2CHG5RJO12B--867BJ4ESaI68666GDA1---5--------1----------------1---------------------------9BB78---76221311-12222222212221333--2-----2----EE277GG-953222222332132223UI994822354B2A45778777A*111111111111111-1---6412231-22233--22---1-42552325344422666777766664333344443333355---5553G4-3B2223233534D2--1565e-26243F--232-11J--1886J211-------1-1--2-FAA1-1535533377377677H---7--4-1AQ--ZZZPcZUtpgYT45---AG88669G95--------3112--12-----------------------------2---2-145436999865233366CE44433385B2233--2237-2333297AF-1--1--2--------------1-21-111--11111---------222224----------1------------------126-----1-6-------------1--------1---------26991413333333333-33333334333323333325756711123222222222222226-113332--499999999999---------11111-86E111332-----1--1----------1-22224365734354767----------1332222223144411111111111111-------------------1722211-1--121-11-1---31---7MFC9ASBEB-2- -------------2------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 91.1 SQ:SECSTR ####################TTHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHTTccHccccHHHHHHHHHHHHHHHcTTccTHHHHHHTTTHHHHHHHHHHHTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccHHHHGGGGccccccc##HHHHHHHHHHTHHHHHHHHHHHTTTccccccTTTccc DISOP:02AL 246-248| PSIPRED ccccccHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //