[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0579
DDBJ      :CPE0579      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  239/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
:231 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   74->191 PF09335 * SNARE_assoc 7e-12 35.0 %
:HMM:PFM   75->191 PF09335 * SNARE_assoc 3.6e-30 34.2 117/123  
:HMM:PFM   8->105 PF02674 * Colicin_V 0.00018 16.7 96/146  
:BLT:SWISS 26->229 YDJZ_ECOLI 4e-66 56.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80285.1 GT:GENE CPE0579 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 720118..720813 GB:FROM 720118 GB:TO 720813 GB:DIRECTION + GB:GENE CPE0579 GB:PRODUCT conserved hypothetical protein GB:NOTE 231 aa, similar to sp:YDJZ_ECOLI HYPOTHETICAL 26.2 KDA PROTEIN IN XTHA-GDHA INTERGENIC REGION from Escherichia coli (235 aa); 55.7% identity in 219 aa overlap. Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80285.1 LENGTH 231 SQ:AASEQ MKKIVKPWVATLIILIVAFLVYFFVPTANSKINQMIFYLSSMNLDMIKEYILSFGIWAPITSFLLMVLQSVIAPIPAFLITLSNAAIFGWVKGAILSWSSAMAGAALCFYIARGLGRDAVEKLTSKFALKDIDGFFEKYGKHTILIARLLPFISFDLVSYAAGLTSMNFWSFFIATGIGQLPATIVYSYVGGMLTGGAQLLMSGLLILFALSIAIYVGKKVWNEKRGKNDK GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 26->229|YDJZ_ECOLI|4e-66|56.4|204/235| TM:NTM 6 TM:REGION 9->31| TM:REGION 59->81| TM:REGION 93->115| TM:REGION 142->164| TM:REGION 170->192| TM:REGION 197->218| RP:PFM:NREP 1 RP:PFM:REP 74->191|PF09335|7e-12|35.0|117/119|SNARE_assoc| HM:PFM:NREP 2 HM:PFM:REP 75->191|PF09335|3.6e-30|34.2|117/123|SNARE_assoc| HM:PFM:REP 8->105|PF02674|0.00018|16.7|96/146|Colicin_V| OP:NHOMO 369 OP:NHOMOORG 254 OP:PATTERN -------1--------------------1-1------------------------------------- 1-----11111111---11-1-----11111------111-------1------------11---1--1-------------1--1-------------1---21----------------------------------11---1-523222111--111---11--2431---1----11-111--------2222222212112221--11132111-1-13223333211---------------2---1---------------------------------11111111111111-------------1---------34-2-4444434-41--11-222-1--3---2-33-212--1-1113---111-11-------------------------------1--1----------------------11-2---1----1--------2---------------------------------------1-------------1-------1-------------------------------1-----------------------211--11--1--2---141-------11---1----------------12-----11-21-----1------1--------1------12-1----------1--1111111111-1111111111111111112222----------------------1111111-----------------------1111-11------------------------1-----------------1--------------111-----11-11----------------2------------------------------------------------------1- ----32------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------1213221-1-------2------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 229-231| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //