[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0587
DDBJ      :CPE0587      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.84.3
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  2->103 2gprA_ b.84.3.1 * 1.7e-09 22.5 %
:HMM:PFM   8->81 PF00358 * PTS_EIIA_1 1e-06 24.3 74/133  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80293.1 GT:GENE CPE0587 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 728859..729182 GB:FROM 728859 GB:TO 729182 GB:DIRECTION + GB:GENE CPE0587 GB:PRODUCT hypothetical protein GB:NOTE 107 aa, no significant homology. GB:PROTEIN_ID BAB80293.1 LENGTH 107 SQ:AASEQ MLNKSDNEIYIMAPSEGNVLDYIVLNNAFNLEDLEEIISLNSHNEFLFSPVNGEVINISKDYGFVEIEMKEGVNIIVSTYINKNIKVVEPMVDIDGKVLTGQIPYVF GT:EXON 1|1-107:0| HM:PFM:NREP 1 HM:PFM:REP 8->81|PF00358|1e-06|24.3|74/133|PTS_EIIA_1| HM:SCP:REP 2->103|2gprA_|1.7e-09|22.5|102/0|b.84.3.1|1/1|Duplicated hybrid motif| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cccccccEEEEEEcccccEEEEEEEcccccHHHHHHHHcccccccEEEEcccccEEEEEccccEEEEEEccccEEEEEEEEcccEEEEEEEEccccEEEEEcccccc //