[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0589
DDBJ      :CPE0589      probable pyrazinamidase/nicotinamidase
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  35/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->162 1im5A PDBj 1e-08 27.6 %
:RPS:PDB   37->217 3eefA PDBj 3e-21 24.2 %
:RPS:SCOP  34->217 1nf8A  c.33.1.3 * 4e-23 12.4 %
:HMM:SCOP  36->215 1im5A_ c.33.1.3 * 3.9e-26 29.2 %
:RPS:PFM   40->161 PF00857 * Isochorismatase 2e-11 38.3 %
:HMM:PFM   38->200 PF00857 * Isochorismatase 7.2e-35 28.2 156/174  
:BLT:SWISS 40->192 YUEJ_BACSU 1e-05 29.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80295.1 GT:GENE CPE0589 GT:PRODUCT probable pyrazinamidase/nicotinamidase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 730721..731380 GB:FROM 730721 GB:TO 731380 GB:DIRECTION + GB:GENE CPE0589 GB:PRODUCT probable pyrazinamidase/nicotinamidase GB:NOTE 219 aa, similar to pir:C72372 pyrazinamidase/nicotinamidase-related protein from Thermotoga maritima (strain MSB8) (214 aa); 30.2% identity in 159 aa overlap. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB80295.1 LENGTH 219 SQ:AASEQ MDTKELLLSESNEMISGIYERLQSLESLELKSLDKNRTMLLIVDINKGFAKAGALYSDRIEKLINPISNLAKYALNNGIRVKAFTDYHTEDSIELKAYPKHCMKDTDEWELVEELNLEGIEVIKKNSTNGFLEENFILNKEEIDNVIIVGDCTDICIYQLAISLRAEFNRVNKDGEIYVPKKLVDTFDMPMHKANFMNYVFLNSMLDNGVKVIEDIILD GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 40->192|YUEJ_BACSU|1e-05|29.3|147/183| SEG 20->33|erlqsleslelksl| BL:PDB:NREP 1 BL:PDB:REP 40->162|1im5A|1e-08|27.6|123/179| RP:PDB:NREP 1 RP:PDB:REP 37->217|3eefA|3e-21|24.2|165/168| RP:PFM:NREP 1 RP:PFM:REP 40->161|PF00857|2e-11|38.3|120/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 38->200|PF00857|7.2e-35|28.2|156/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 34->217|1nf8A|4e-23|12.4|170/207|c.33.1.3| HM:SCP:REP 36->215|1im5A_|3.9e-26|29.2|168/179|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 49 OP:NHOMOORG 46 OP:PATTERN --1--1-1-------1-11---11-------------------------------1------------ ----------------------------------------------------------------------------------------------------------------------------------------11111---11--------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1------------11111111-1---------1-1--1--111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------11--11-111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--2------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 83.1 SQ:SECSTR #################################cTTcEEEEEEccHHHHTcTTcccccHHHHHHHHHHHHHHHHHHTTccEEEEEEcccTTcTTHGHHHccccTTcGGGcccGGGcccTTcEEEEccccTTTTccHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTc##HHTTcEEEEEEEEEEccccTTHHHHHHHHHHHHHHHccEEEcTTccc## DISOP:02AL 1-2| PSIPRED ccHHHHHHHcccHHHHHHHHHHccccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccHHHcHHHcccccEEEEccccccccccHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHcc //