[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0600
DDBJ      :CPE0600      probable amino acid ABC transporter
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  684/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   47->262 1wdnA PDBj 1e-31 35.9 %
:RPS:PDB   47->262 3delB PDBj 3e-38 23.1 %
:RPS:SCOP  45->265 1ii5A  c.94.1.1 * 2e-41 24.5 %
:HMM:SCOP  6->265 2a5sA1 c.94.1.1 * 2.3e-60 40.2 %
:RPS:PFM   53->262 PF00497 * SBP_bac_3 1e-23 33.7 %
:HMM:PFM   48->264 PF00497 * SBP_bac_3 2.2e-58 35.5 214/225  
:BLT:SWISS 48->262 ARTP_BACSU 3e-39 42.2 %
:PROS 73->86|PS01039|SBP_BACTERIAL_3
:REPEAT 2|152->199|202->261

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80306.1 GT:GENE CPE0600 GT:PRODUCT probable amino acid ABC transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 750652..751488 GB:FROM 750652 GB:TO 751488 GB:DIRECTION + GB:GENE CPE0600 GB:PRODUCT probable amino acid ABC transporter GB:NOTE 278 aa, similar to sp:YQIX_BACSU PROBABLE AMINO-ACID ABC TRANSPORTER EXTRACELLULAR BINDING PROTEIN YQIX PRECURSOR from Bacillus subtilis (255 aa); 38.3% identity in 256 aa overlap binding protein GB:PROTEIN_ID BAB80306.1 LENGTH 278 SQ:AASEQ MKKNIFKKILSVAMIGGLTLSLAGCGAKTAKENGSSDKVAKIKESGKLVVGLSADYAPYEFHIMKDGKDQIVGLDIDIAKEVAKNLGVDLEIKEMEFGAIIQSVKNGMIDMGISGITPDEKRKEAVDFSDIYYEAEQGILINKDNKESIKGIGDLKGKKVGAQMGSIQAEIAKGIEGADVKLLDNVNTLILELKTGKLDAVITELPVAKIASEVNSELAVADEVIKNSEGGSAIAIQKGNKDLVDKVNSTIKELKENGKIDQFTNDAIELVPYQKKEE GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 48->262|ARTP_BACSU|3e-39|42.2|206/255| PROS 73->86|PS01039|SBP_BACTERIAL_3|PDOC00798| NREPEAT 1 REPEAT 2|152->199|202->261| BL:PDB:NREP 1 BL:PDB:REP 47->262|1wdnA|1e-31|35.9|209/223| RP:PDB:NREP 1 RP:PDB:REP 47->262|3delB|3e-38|23.1|212/232| RP:PFM:NREP 1 RP:PFM:REP 53->262|PF00497|1e-23|33.7|205/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 48->264|PF00497|2.2e-58|35.5|214/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 45->265|1ii5A|2e-41|24.5|212/222|c.94.1.1| HM:SCP:REP 6->265|2a5sA1|2.3e-60|40.2|246/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3027 OP:NHOMOORG 717 OP:PATTERN 11---1----------1-2222212--11-1111----75873-1113----1----1------1--- ----322211122231111-17111D111111877736A913224131222-656123--112-7426461644465421311--------------------------111111111111111--------4----11111111--112--21111-------1--1131------------2441111--243444447544554453332654453225544433333A422222222222222222223564798875466566883646842225556555377656767766675555455554555388A9988871355B45355552323433233323121322317715121-211111128---111112112--622--------5653526656K---4--3-64911KEEBA89DBECGB3---118312321311111111111-1--2----------111111111111111--1-1-----58669EIIIJF77887CCEI888868IDJ3551--5672243265B79D-12----743322222----2-14A2676934977635146-421121-21--3-6437333332111111111-22----565-21----6-1111--11111111111-1-4-1-1------76CB5886665664666-6666666566666566557DEDBB442B678798888988887B665656631767777776777--3-111114555--46833343321111222144434-22541-87787DBD668663887----------44474444444533----------------27----11--------1-33-3----------------------121-123112--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1--1-----------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 99.6 SQ:SECSTR #HHHHHHTTTcETTTTTEEcccTTTcEEEEHHHcccccccccTTcEEEEEEEccccTTTcEEEcEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEcccccccccGGGcccEEEETTcHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcTTEEEEEEEccGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHGGTTccEEEEEEEHHc DISOP:02AL 1-5, 275-278| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccEEEEEEccccccEEEEEcccccccEEEEHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEEcEEEEEEcccccccccHHHHcccEEEEEcccHHHHHHHHcccccEEEEccHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEccccccccccEEEEEccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccc //