[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0622
DDBJ      :CPE0622      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   75->184 2cweA PDBj 7e-04 29.9 %
:RPS:SCOP  47->139 2ewrA1  d.218.1.11 * 1e-06 16.9 %
:RPS:PFM   63->212 PF04991 * LicD 3e-04 34.4 %
:HMM:PFM   62->212 PF04991 * LicD 2.8e-23 32.9 146/191  
:HMM:PFM   18->74 PF02636 * DUF185 0.00026 32.1 56/250  
:BLT:SWISS 44->230 FKTN_HUMAN 2e-18 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80328.1 GT:GENE CPE0622 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 778167..778907 GB:FROM 778167 GB:TO 778907 GB:DIRECTION + GB:GENE CPE0622 GB:PRODUCT hypothetical protein GB:NOTE 246 aa, pertially similar to gp:AB038490_1 fukutin from Homo sapiens (461 aa); 28.9% identity in 187 aa overlap. Also partially similar to gp:AF052516_2 hemolysin erythrocyte lysis protein from Provotella intermedia GB:PROTEIN_ID BAB80328.1 LENGTH 246 SQ:AASEQ MSKVKRKLKNIVRNIMLSETFANTNLVKNMRKNHKEKLEEGRRVLFKEHAKDCLETIKENLDKNNLHFWLDYGTLLGAMREKDFIAHDLDIDLGMFYENQVEEVEKAFKEANIKKVREFTLDGKVVEQTYSYKGLYFDIFYYFKDENLMWTYGFTFKNNKLNKVSYKDKDVSTGFEGMKYFVKKRGLEKIMFKGKEYTVPENPDGYLRENYGPNYMTPIKEWDYVEAPTNQEKLKGGDIVMIEYYN GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 44->230|FKTN_HUMAN|2e-18|32.1|168/461| BL:PDB:NREP 1 BL:PDB:REP 75->184|2cweA|7e-04|29.9|107/191| RP:PFM:NREP 1 RP:PFM:REP 63->212|PF04991|3e-04|34.4|128/145|LicD| HM:PFM:NREP 2 HM:PFM:REP 62->212|PF04991|2.8e-23|32.9|146/191|LicD| HM:PFM:REP 18->74|PF02636|0.00026|32.1|56/250|DUF185| RP:SCP:NREP 1 RP:SCP:REP 47->139|2ewrA1|1e-06|16.9|89/156|d.218.1.11| OP:NHOMO 77 OP:NHOMOORG 63 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------1------11----------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------111-----------------------------------------------------------------------------------------------------------------------------------1----1-1--11----------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1--2-111111-1111111-1-262-21111--1-1111111111-1111111-1115--------21------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 43.5 SQ:SECSTR ##########################################################################HHHHHTTccccHHHHHHHHTccHHHHHHHHHH#HHHTTcEEEEEEEEETTEEEEEEEEcccEEEEcTTcccHHHHHHTTccccHHHHHHHHHHHHHHHHHHH##HHHHTT############################################################## DISOP:02AL 1-6| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEccccHHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEEcccEEEEEEEEEEcccEEEEccccccccccccccccccccccccccEEEEccccccEEcccccEEEEEcccHHHHHHHHccccccccccccccccccccHHHHccccEEEEEEcc //