[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0660
DDBJ      :CPE0660      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  203/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.1
:254 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->240 3cb8A PDBj 2e-15 33.0 %
:RPS:PDB   22->63 1clfA PDBj 5e-06 35.7 %
:RPS:PDB   92->221 3canA PDBj 1e-09 20.2 %
:RPS:SCOP  22->63 1durA  d.58.1.1 * 1e-07 31.7 %
:HMM:SCOP  16->98 1jnrB_ d.58.1.5 * 8.6e-12 31.3 %
:HMM:PFM   2->194 PF04055 * Radical_SAM 4e-23 30.4 148/166  
:BLT:SWISS 1->188 YJJW_ECOLI 2e-33 36.7 %
:PROS 24->35|PS00198|4FE4S_FER_1
:PROS 53->64|PS00198|4FE4S_FER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80366.1 GT:GENE CPE0660 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 824764..825528 GB:FROM 824764 GB:TO 825528 GB:DIRECTION + GB:GENE CPE0660 GB:PRODUCT conserved hypothetical protein GB:NOTE 254 aa, similar to sp:YJJW_ECOLI HYPOTHETICAL 31.5 KDA PROTEIN IN OSMY-DEOC INTERGENIC REGION (F287) from Escherichia coli (287 aa); 40.8% identity in 206 aa overlap GB:PROTEIN_ID BAB80366.1 LENGTH 254 SQ:AASEQ MVIFFQGCNFKCLYCHNPETINKCTSCGKCVENCEVGALSISEGKVIWDEEECISCDKCIKLCEHMSSPKLKEYSVEELVKKIEKDSFFIRGITVSGGECTLNSEFLIKLFREVKKLGLTCFVDTNGNTKLDDELINLTDKFMLDVKSIDEKENIWLTKSSNKLVLENLKKLLELDKMYEVRTVIAKGLNSEKTVDEVSKIIGDKCRYKLIKYRPFGVREEGIKVHGTISPEDSYMNELKEKSIANGCIDTIIT GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 1->188|YJJW_ECOLI|2e-33|36.7|188/287| PROS 24->35|PS00198|4FE4S_FER_1|PDOC00176| PROS 53->64|PS00198|4FE4S_FER_1|PDOC00176| SEG 159->175|kssnklvlenlkkllel| BL:PDB:NREP 1 BL:PDB:REP 2->240|3cb8A|2e-15|33.0|194/244| RP:PDB:NREP 2 RP:PDB:REP 22->63|1clfA|5e-06|35.7|42/55| RP:PDB:REP 92->221|3canA|1e-09|20.2|129/158| HM:PFM:NREP 1 HM:PFM:REP 2->194|PF04055|4e-23|30.4|148/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 22->63|1durA|1e-07|31.7|41/55|d.58.1.1| HM:SCP:REP 16->98|1jnrB_|8.6e-12|31.3|83/149|d.58.1.5|1/1|4Fe-4S ferredoxins| OP:NHOMO 365 OP:NHOMOORG 208 OP:PATTERN -----------------------1-----------------1----------------1-1---1--- --------------------------------------------------------------1--------11111111--1--------11-2--------------------------------------------------------------------------------------------------1-111111111111111------111--------------------------------------------------------------------1--------------------------1--111-----42-3333333343312113111121----1--33-31--11-----1-1---------------------1---------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------6211-2211322---2--11-2-----------1------------------------212---------2222-2211121222212-------------21--12-3334344433-333333434334333333412111--12-21212211212112-3333333---11111111111------------------111----1111-------------------------------------------11111111111111----------------------------------1-------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 94.5 SQ:SECSTR EEEEEEEcccccTTcTTTTTTTccccccTTTTTcTTccEEEccccEEEcTTTcccccTTTTTcEEccHccccHHHHHHHHHHHHTcTTccEcEEEcccTGGGcHHHHHHHHHHHHHTTccEEEEcTTcccHHHHHHHTccEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHTTccEEEEEEEccTTTcHHHHHHHHHHHHHcccccEEEEEEccccccccTTTTcccccHHHHHHHH############## PSIPRED cEEEcccccccccccccHHHHHHccccccHHHHcccccEEEEccEEEEEHHHHcccccHHHHccccccHHHHccHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHccccEEEEEEccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccc //