[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0703
DDBJ      :CPE0703      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   28->60 PF03804 * DUF325 0.00038 36.4 33/71  
:HMM:PFM   56->95 PF01846 * FF 0.00069 37.5 32/51  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80409.1 GT:GENE CPE0703 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 877378..877893 GB:FROM 877378 GB:TO 877893 GB:DIRECTION + GB:GENE CPE0703 GB:PRODUCT hypothetical protein GB:NOTE 171 aa, no significant homology. GB:PROTEIN_ID BAB80409.1 LENGTH 171 SQ:AASEQ MEERIENLQRIIKNILASTDDQIQGDLRDSLRLRMSVSENLHGEVRYLKCLRALVEEKFQEFFKKKNFPKDYNDFVGIWSSLSEEAKSLCNDPKYDYDEEKYKYEFIYFEVYCNVYLRYSLGLLFNGNNKDTIDDLSQYNSLEIIQMYRYYLHQITLKKLEKSLKSDKVNS GT:EXON 1|1-171:0| SEG 56->68|eekfqeffkkknf| SEG 92->105|dpkydydeekykye| SEG 157->168|lkklekslksdk| HM:PFM:NREP 2 HM:PFM:REP 28->60|PF03804|0.00038|36.4|33/71|DUF325| HM:PFM:REP 56->95|PF01846|0.00069|37.5|32/51|FF| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 165-171| PSIPRED cHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHEEHHHHHHHHHHHHEEEEEccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccc //