[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0719
DDBJ      :CPE0719      probable capsular polysaccharide biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  532/915 : Eukaryota  74/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->108 2z87B PDBj 2e-14 42.7 %
:RPS:PDB   10->221 2bo7A PDBj 1e-23 11.2 %
:RPS:SCOP  6->237 1omxA  c.68.1.15 * 1e-33 15.9 %
:HMM:SCOP  8->257 1qg8A_ c.68.1.1 * 1.2e-45 31.1 %
:RPS:PFM   10->112 PF00535 * Glycos_transf_2 3e-23 52.9 %
:RPS:PFM   155->276 PF03332 * PMM 7e-05 34.0 %
:HMM:PFM   10->167 PF00535 * Glycos_transf_2 2.3e-35 34.6 156/169  
:HMM:PFM   234->303 PF03172 * Sp100 1.4e-05 25.0 68/104  
:BLT:SWISS 9->226 EPSJ_BACSU 2e-21 30.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80425.1 GT:GENE CPE0719 GT:PRODUCT probable capsular polysaccharide biosynthesis protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 893608..894612 GB:FROM 893608 GB:TO 894612 GB:DIRECTION + GB:GENE CPE0719 GB:PRODUCT probable capsular polysaccharide biosynthesis protein GB:NOTE 334 aa, similar to prf:2315479K epsG gene from Lactococcus lactis (316 aa); 31.8% identity in 255 aa overlap GB:PROTEIN_ID BAB80425.1 LENGTH 334 SQ:AASEQ MALMSDKFLSIVIPAYNSEKYIEKNLMFLSRQTSNNFEVIVVDDGSTDNTCEVSEACLENFKINHRVIRCEENRGQSVARNIGINYSRGKYILFLDSDDFAENNLVQILERNMFNEPDIVFFDYKRIKEGDSVNVNIAQNFEFGKIKSGEEVFNAYKDNKIRLWTGSLVYNKEFLNKNKLRFLEGAHGAEDLNFIFKALLSSKKVRGIEDSLVFYCQRGDSLTNNPDIYKNITVVESMEDVAKFIDENKLDKKLKEAIEKEFTCEHIMYQILGYLNSETKKDTLSVLKNKNVKKYLKKATIKTNRYGRSMYTYMKMAAYFPNLFIKTYLKNTGK GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 9->226|EPSJ_BACSU|2e-21|30.8|214/344| SEG 286->298|vlknknvkkylkk| BL:PDB:NREP 1 BL:PDB:REP 9->108|2z87B|2e-14|42.7|96/591| RP:PDB:NREP 1 RP:PDB:REP 10->221|2bo7A|1e-23|11.2|205/375| RP:PFM:NREP 2 RP:PFM:REP 10->112|PF00535|3e-23|52.9|102/148|Glycos_transf_2| RP:PFM:REP 155->276|PF03332|7e-05|34.0|103/219|PMM| HM:PFM:NREP 2 HM:PFM:REP 10->167|PF00535|2.3e-35|34.6|156/169|Glycos_transf_2| HM:PFM:REP 234->303|PF03172|1.4e-05|25.0|68/104|Sp100| GO:PFM:NREP 3 GO:PFM GO:0004615|"GO:phosphomannomutase activity"|PF03332|IPR005002| GO:PFM GO:0005737|"GO:cytoplasm"|PF03332|IPR005002| GO:PFM GO:0019307|"GO:mannose biosynthetic process"|PF03332|IPR005002| RP:SCP:NREP 1 RP:SCP:REP 6->237|1omxA|1e-33|15.9|220/250|c.68.1.15| HM:SCP:REP 8->257|1qg8A_|1.2e-45|31.1|238/255|c.68.1.1|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1404 OP:NHOMOORG 646 OP:PATTERN 11-----12111-2----1----12-----1-BA12111-1--1212112322-32344121--1--1 --2--1-1-------------------------1-1-------2-22-2--11--1----12-----656251115422243--1121AFD8-A12---B-5552316-5--------------2212132312131--13---1-258F456--11---1-2-243AE651-21-31-21111--11331--5212124411143432454436313-2215--21141121212111111111111521254212344112333223426323165A233-------42262446271-------------444324444-1--5333322322542322-511212--1451-21221-121-12---12-21---1-----3-2--111-------------------1--2--22--222-351234-2-111-------11-----------22--112------------222212221-111-------1-1-2221---3--------------------1---------112-1---1---11-111-1-112211-11-1-4133-55-31---3182232454--1-1-321-21363342414-1--111--13311---2342-21--1-2---321-1--21-21---1121------22---131223143223-1213312321221221221112-223311111111111111113-22--12--111111111113--11---------222--1--12-112121--311111-21--5322221-21------111622222222--112-----1-3---11-------------14225544111111115-----------1------2-31-----11-21--111315 ----31--------------------------------------------------------111-11-111--111111111111---------------------1-1--1---1---1-111111-261-1121---1-111-1--11--11311111-1111--11-22-11-1-----1-2112-21-----1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 231 STR:RPRED 69.2 SQ:SECSTR #HHcccccEEEEEEEccccHHHHHHHHHHHHHcTTTccEEEEEEccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEEccTTccccHHHHHHHHHHHHHTccEEEEEccccTTccHHHHHTHHHHHHHHcTTcccccTccGGGcccTTcccEEEEHHHHHHHHHHHHTcccTTHHHHHHHHHHHTTccEEEEEcTTcccccccHHccTTcccccHH###################################################################################################### DISOP:02AL 1-4| PSIPRED ccccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHccccEEEEEEEEEEccccEEEcccccccccccccHHHHHHHHHcccccccccHHEEEHHHHHHccccccccccEEccHHHHHHHHHHcccEEEEccEEEEEEEccccEEccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHEEEEEEccccc //