[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0722
DDBJ      :CPE0722      probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  537/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.124.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->219 3dlxB PDBj 3e-23 12.5 %
:RPS:SCOP  2->24 1lvaA4  a.4.5.35 * 6e-05 17.4 %
:RPS:SCOP  37->203 2ahuA2  c.124.1.2 * 1e-21 8.4 %
:HMM:SCOP  2->47 1stzA1 a.4.5.51 * 0.00016 41.9 %
:HMM:SCOP  39->204 1lk5A1 c.124.1.4 * 3.7e-25 24.8 %
:RPS:PFM   2->24 PF08220 * HTH_DeoR 2e-05 65.2 %
:RPS:PFM   44->200 PF00455 * DeoR 4e-25 40.6 %
:HMM:PFM   44->200 PF00455 * DeoR 1.8e-35 34.8 155/157  
:HMM:PFM   2->27 PF08220 * HTH_DeoR 3.7e-09 53.8 26/57  
:BLT:SWISS 3->219 GLCR_BACSU 5e-25 33.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80428.1 GT:GENE CPE0722 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 897523..898185 GB:FROM 897523 GB:TO 898185 GB:DIRECTION + GB:GENE CPE0722 GB:PRODUCT probable transcriptional regulator GB:NOTE 220 aa, similar to gpu:AP001512_140 transcriptional regulator (DeoR family) from Bacillus halodurans (251 aa); 33.6% identity in 238 aa overlap DeoR family GB:PROTEIN_ID BAB80428.1 LENGTH 220 SQ:AASEQ MIRKDLQKLEQEGLLKRTYGGAILERQTIHDDNIRPRLMKNLGEKDIIAKLALKEIKDGDFIFLDASTTNYSIASMLLNTKKQVTVVTNMNRIAILFDSHPSIDVICIGGIYNKNLGGTIGSKAIEDVKSYRFHKAFVGVGGINLVEDFISNFNLEEASMKNAIIKSSLKTYLVAENEKFYTDGICEFAKCEDIDFIISDKKPNEEILKLLKERNISIIY GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 3->219|GLCR_BACSU|5e-25|33.6|211/258| RP:PDB:NREP 1 RP:PDB:REP 5->219|3dlxB|3e-23|12.5|208/465| RP:PFM:NREP 2 RP:PFM:REP 2->24|PF08220|2e-05|65.2|23/56|HTH_DeoR| RP:PFM:REP 44->200|PF00455|4e-25|40.6|155/157|DeoR| HM:PFM:NREP 2 HM:PFM:REP 44->200|PF00455|1.8e-35|34.8|155/157|DeoR| HM:PFM:REP 2->27|PF08220|3.7e-09|53.8|26/57|HTH_DeoR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| RP:SCP:NREP 2 RP:SCP:REP 2->24|1lvaA4|6e-05|17.4|23/60|a.4.5.35| RP:SCP:REP 37->203|2ahuA2|1e-21|8.4|167/273|c.124.1.2| HM:SCP:REP 2->47|1stzA1|0.00016|41.9|43/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 39->204|1lk5A1|3.7e-25|24.8|145/150|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 1867 OP:NHOMOORG 541 OP:PATTERN ------------------------2--1---------------------------------------- 32--6122113111-------3---3------322212221--12-1-112-6341-4--1-33347453311111112---1--------1--------12--14-5-A--------------------------22211----------------------------1-------------3----22-31433333334143333365442434411123236666665A2222222222222224322341-1371-32244--661311--3433333333344444444444444444444444444433221333551177332334353413--244222-3-2121----1--1--42226222--12--------1-112---1311144444444444---1--1-218--8554343876432----1124134111111111113112---3-----------------------------------111112444432222233562222124242231--1211-1111-1224-------311111111--------2---12--1---1-------11-----1-----------------------------4392--11-1221111--122211111111-------------7466551A98BABABAA-9BAA9A9A9A9CA9AABA5BAC45432B8CBCBCBBABBABBB9877AA981-644444434444---------------116333746223225764----------1122121433211112344----------333433333432551111111----------4---------------------1---2-1------21-------41--12111-11 -------------2-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 100.0 SQ:SECSTR THHHcTTcccGGGccccGGGccEEEEcccccccccccccccHHHHHHHHHHGHGGccTTEEEEEcTTHHHHHGGGccHTTTccEEEEETTTEEEEccGGGccTTcccTTcccccEEEEEcHHHHHHHHHTTcccEEEEcccEEETEEccccTTcccccTTHHHHTccTTcEEEEEcEEcEEccccccccccccccEEEcccEEEEEETTEETTTEEEEEE DISOP:02AL 28-41| PSIPRED cccHHHHHHHHcccEEEEEcEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccEEEEEccEEEccccEEEcHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEcHHHccEEEEcccccHHHHHHHHHcccEEEc //