[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0737
DDBJ      :CPE0737      probable fibronectin-binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:220 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->213 PF07299 * FBP 8e-36 40.1 %
:HMM:PFM   4->216 PF07299 * FBP 4.4e-74 45.1 206/208  
:BLT:SWISS 9->68 Y907_METJA 5e-04 35.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80443.1 GT:GENE CPE0737 GT:PRODUCT probable fibronectin-binding protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(914540..915202) GB:FROM 914540 GB:TO 915202 GB:DIRECTION - GB:GENE CPE0737 GB:PRODUCT probable fibronectin-binding protein GB:NOTE 220 aa, similar to >gp:LMO132543_1 fibronectin-binding protein, 25kDA from Listeria monocytogenes (215 aa); 30.6% identity in 219 aa overlap GB:PROTEIN_ID BAB80443.1 LENGTH 220 SQ:AASEQ MKPFIKKEDFNFIKKCITDLHGTLRNCTDHNIIETNKAYINEKILSRFSELSNEEKELIDINKITDPLHIDKYLEDLNEYVYGMTAIKSNAITKLFRKEKKLKIPNLDFESSKKVYLGWIDEGSRKLFIAYNLNGKLTGMACKIPSYNSSNNHICTLCNHIGNDTEVAFVSALCKTSNPEQGTYRSIGFDICLDSEKCNERITSTDKLEKLLKDVNNIKK GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 9->68|Y907_METJA|5e-04|35.0|60/100| RP:PFM:NREP 1 RP:PFM:REP 5->213|PF07299|8e-36|40.1|202/207|FBP| HM:PFM:NREP 1 HM:PFM:REP 4->216|PF07299|4.4e-74|45.1|206/208|FBP| OP:NHOMO 43 OP:NHOMOORG 43 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111--11--111---1-1111111111-----1-------------11-1--------11---------------------------------------------------------------------1-1-----111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 92-93, 174-183| PSIPRED cccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccEEEEEEccccEEEEEEEEccccccccccEEEEEEccccccEEEEEEEcccccccccccEEcccEEEccHHHHHHHcccHHHHHHHHHHHHHHcc //