[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0764
DDBJ      :CPE0764      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   118->183 2ganB PDBj 7e-05 35.5 %
:RPS:PDB   4->205 2cnmA PDBj 4e-06 16.5 %
:RPS:PDB   130->194 3ec4A PDBj 6e-09 16.9 %
:RPS:SCOP  4->192 2atrA1  d.108.1.1 * 3e-09 25.2 %
:HMM:SCOP  1->192 2ganA1 d.108.1.1 * 6.8e-17 24.8 %
:HMM:PFM   61->183 PF00583 * Acetyltransf_1 3e-10 28.9 76/83  
:BLT:SWISS 3->170 RPOA_MYCH2 5e-04 28.8 %
:BLT:SWISS 100->183 YCF52_PORYE 2e-04 27.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80470.1 GT:GENE CPE0764 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(944309..944938) GB:FROM 944309 GB:TO 944938 GB:DIRECTION - GB:GENE CPE0764 GB:PRODUCT hypothetical protein GB:NOTE 209 aa, no significant homology. GB:PROTEIN_ID BAB80470.1 LENGTH 209 SQ:AASEQ MKDVIYRDVKKEDLCEFENLIKDAFNFDKFIHNKELLKVITSSYLKESICESSFIKVASKGDKVLGFILCKADGDKANYNHLFTPLNEEKYPTTLPIENIKDENEITEFIKIKEAYSELLNGKENLFDSCINLFIVSEESRGLGIGKTLLNYSLKYMHSMKSSSLYLFTDDRCNYGFYKSQGFNCLDEVDVYLKTVDSNFKTFLYTYSY GT:EXON 1|1-209:0| BL:SWS:NREP 2 BL:SWS:REP 3->170|RPOA_MYCH2|5e-04|28.8|156/100| BL:SWS:REP 100->183|YCF52_PORYE|2e-04|27.7|83/174| BL:PDB:NREP 1 BL:PDB:REP 118->183|2ganB|7e-05|35.5|62/176| RP:PDB:NREP 2 RP:PDB:REP 4->205|2cnmA|4e-06|16.5|139/151| RP:PDB:REP 130->194|3ec4A|6e-09|16.9|65/218| HM:PFM:NREP 1 HM:PFM:REP 61->183|PF00583|3e-10|28.9|76/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 4->192|2atrA1|3e-09|25.2|123/132|d.108.1.1| HM:SCP:REP 1->192|2ganA1|6.8e-17|24.8|153/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 94.3 SQ:SECSTR ccccEEEEccGGGHHHHHHHHHHHccccccHHHHHHHHcccccccEEEEEEccGGGccTTcccEEEEEEEEEEETTTEEEEEEEcccTTcE########EEETTEEEEEEEEcEEEEEEEccccccEEEEEEEEEEcGGGTTccHHHHHHHHHHHHHHTTcEEEEEEETTcHHHHHHHHHTTcEEEEEEEEEEEETTEEEEEEEE#### DISOP:02AL 1-2| PSIPRED cccEEEEEEEcccHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHHEEEcccEEEEEEEEcccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHcccEEEEEEEccEEEEEEEEcccccEEEEEccccccccccccEEEEEEcc //