[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0765
DDBJ      :CPE0765      probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:267 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->41 1r8eA PDBj 5e-07 52.6 %
:RPS:PDB   3->265 3d71A PDBj 2e-13 17.8 %
:RPS:SCOP  1->67 1j9iA  a.6.1.5 * 6e-13 13.4 %
:HMM:SCOP  3->124 1q06A_ a.6.1.3 * 3.5e-26 36.9 %
:RPS:PFM   4->41 PF00376 * MerR 8e-07 56.8 %
:HMM:PFM   4->41 PF00376 * MerR 1.1e-16 50.0 38/38  
:HMM:PFM   46->103 PF09278 * MerR-DNA-bind 7.4e-10 32.8 58/65  
:HMM:PFM   148->196 PF11686 * DUF3283 0.00073 28.6 49/61  
:BLT:SWISS 1->176 MERR_BACCE 3e-06 28.7 %
:BLT:SWISS 4->48 YDFL_BACSU 5e-09 51.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80471.1 GT:GENE CPE0765 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 945090..945893 GB:FROM 945090 GB:TO 945893 GB:DIRECTION + GB:GENE CPE0765 GB:PRODUCT probable transcriptional regulator GB:NOTE 267 aa, similar to gpu:AP001519_11 transcriptional regulator of multidrug-efflux transporter genes from Bacillus halodurans (271 aa); 26.7% identity in 255 aa overlap MerR family GB:PROTEIN_ID BAB80471.1 LENGTH 267 SQ:AASEQ MKLSIGEVARLFNISKDTLRYYDKIGILKPEINKENGYRFYDIRHLEQLGLILGIKYLGISLSEIKEIIENGDIEDYYNLMQKQKDIIKERILELKKLEESLDNSGQVINRIMNFKNQYDFSKVNVENLDLKLYEVKVRSALDLENESKVEKKLIELKDEAYFYFYEIKDNKHIIEEENLLFIKSNENIEKFLKKSKSKDKITFKSIQGKFALVDFYGTVEEIHNYILSMNKYFKGNIDNYAFIEYEFYLPKKREEVKYFVRIYLSL GT:EXON 1|1-267:0| BL:SWS:NREP 2 BL:SWS:REP 1->176|MERR_BACCE|3e-06|28.7|122/132| BL:SWS:REP 4->48|YDFL_BACSU|5e-09|51.1|45/270| SEG 49->62|lglilgikylgisl| SEG 87->100|iikerilelkklee| SEG 189->207|iekflkkskskdkitfksi| BL:PDB:NREP 1 BL:PDB:REP 4->41|1r8eA|5e-07|52.6|38/275| RP:PDB:NREP 1 RP:PDB:REP 3->265|3d71A|2e-13|17.8|258/277| RP:PFM:NREP 1 RP:PFM:REP 4->41|PF00376|8e-07|56.8|37/37|MerR| HM:PFM:NREP 3 HM:PFM:REP 4->41|PF00376|1.1e-16|50.0|38/38|MerR| HM:PFM:REP 46->103|PF09278|7.4e-10|32.8|58/65|MerR-DNA-bind| HM:PFM:REP 148->196|PF11686|0.00073|28.6|49/61|DUF3283| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00376|IPR000551| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00376|IPR000551| RP:SCP:NREP 1 RP:SCP:REP 1->67|1j9iA|6e-13|13.4|67/68|a.6.1.5| HM:SCP:REP 3->124|1q06A_|3.5e-26|36.9|122/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 24 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------1---1111221112-1---11--1--------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 99.3 SQ:SECSTR ccEEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcTTGGGHHHHHHHHHHTTccHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTcEEEEEEccTTccTTTccGGGGHHHHHHHHHHHccccccEEEEEcccccccGGGccccEEEEEcccccccccTTcEEEEEccEEEEEEEEEccHHHHHHHHHHHHHHHHHTTccEEEEEEEEEEEccEEccTTccccccEEEEEEE## DISOP:02AL 151-152| PSIPRED ccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEEccccHHHHHHHHHHHHHccEEEEccccEEHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHcc //