[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0795
DDBJ      :CPE0795      probable iron(III) dicitrate ABC transporter
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  198/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:256 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   2->254 2it1B PDBj 2e-30 32.5 %
:RPS:PDB   2->228 3b5jA PDBj 1e-41 26.8 %
:RPS:SCOP  13->235 1l7vC  c.37.1.12 * 7e-39 29.7 %
:HMM:SCOP  6->220 1ii8.1 c.37.1.12 * 1.5e-65 35.4 %
:RPS:PFM   17->58 PF03193 * DUF258 3e-05 48.8 %
:RPS:PFM   41->166 PF00005 * ABC_tran 5e-13 33.6 %
:HMM:PFM   41->166 PF00005 * ABC_tran 3e-21 30.7 114/118  
:HMM:PFM   11->58 PF03193 * DUF258 5.5e-07 34.0 47/161  
:BLT:SWISS 2->255 YUSV_BACSU 4e-79 50.8 %
:PROS 138->152|PS00211|ABC_TRANSPORTER_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80501.1 GT:GENE CPE0795 GT:PRODUCT probable iron(III) dicitrate ABC transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 978511..979281 GB:FROM 978511 GB:TO 979281 GB:DIRECTION + GB:GENE CPE0795 GB:PRODUCT probable iron(III) dicitrate ABC transporter GB:NOTE 256 aa, similar to pir:G70022 iron(III) dicitrate transport permease homolog yusV from Bacillus subtilis (275 aa); 50.6% identity in 257 aa overlap ATP-binding protein GB:PROTEIN_ID BAB80501.1 LENGTH 256 SQ:AASEQ MIKTNNLKLCYDEKIILDDINIEIEKGKITALIGPNGCGKSTLIKSISKILTPKSGEVLMGDKNLLKMPPKELAKELAMLPQSSSAPEDLTIYDLVKQGRYPYHNLLSFWSKKDEEIVMESIRKMGLIEEKDRTLENLSGGQRQRAWIALSLCQDTEVILLDEPTNHLDIKYQLEILNILKELNRKENRTIVMVIHDINHALRYADNIIALKDGNIFAQGSKDKIINEDLIKNVFDIKCRIIDSPIDNSKMCVTYI GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 2->255|YUSV_BACSU|4e-79|50.8|254/275| PROS 138->152|PS00211|ABC_TRANSPORTER_1|PDOC00185| BL:PDB:NREP 1 BL:PDB:REP 2->254|2it1B|2e-30|32.5|243/361| RP:PDB:NREP 1 RP:PDB:REP 2->228|3b5jA|1e-41|26.8|224/243| RP:PFM:NREP 2 RP:PFM:REP 17->58|PF03193|3e-05|48.8|41/160|DUF258| RP:PFM:REP 41->166|PF00005|5e-13|33.6|122/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 41->166|PF00005|3e-21|30.7|114/118|ABC_tran| HM:PFM:REP 11->58|PF03193|5.5e-07|34.0|47/161|DUF258| GO:PFM:NREP 4 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 13->235|1l7vC|7e-39|29.7|212/231|c.37.1.12| HM:SCP:REP 6->220|1ii8.1|1.5e-65|35.4|212/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 52356 OP:NHOMOORG 1175 OP:PATTERN YYPDVRMOeddZdZfTlLSRPQNbxRUlqVkVKBDDFEJHIHFWaUamMR**lBUhTWcQUMLJb2BC UdpN*geduuwadWSRUJJ-JZ99U*JJJJJLponps***U*S*n*vdrohP**wSPeGGrxzj*o****beccczgdeS*jnCAEACccZS6SHJM-1IJYOPNlUaMW8AAAAAADEDCCCCMWSLRZOPVTaUlooyxMLM*ZunrvjhmdjYZSJOLPGihXk***YOWKONLMWMOJLladQOymCYhy************************jpz**pt********astsqsomppssspnemhih*rfj**iPmex**VV**hcVatomstpqvzxv****y*xyuu**wyyigihhijkkjihi*yxmlmyx*ru***********o*s****fqpm**n***uwWM**wldgjpTapivvSkiaOeSRRKLOONPeU***ZQu****************-ek*dW*f***QD**************IJM**********QPQQQQQQlTXHOjb*77657555668AA8DE8AAAA9AABA8C7LEBBCG***********wwwxu********k********BNwwr*ivmr******epeLWNSmVLNLLNMLPPNZnfg**RlXxhZgxcbnLhcbTTZhWWZWSYozZ*RMNVGNNNONHEDGGGFGEEMTIHMLKqq*SrYlLXP*QVbcXRajYXXVVYgeYhf7-GLQOM331444****c************-******************y*****ptmvxttuvwvwuutwtts*xttyyy*W5************45MLFJEFGPPSQOI*p*dccacbLQWRQYQViSUWUUJVJRXmfy*ywx***v***yn***IFFDFIGFFMott*uuvvu*****NPQONPOMPPCCCC89LXWVMNLMBCACBCCC*BbFBCDK-HGGGLKESRPEJREKJCCDgr*bav*wuvGXQ 4588egI1bMEFUdUJJPFGNRIUNTIHHFFFGOLMDNJKJKJGFEHJLUUOZSGKNEDFFFH9E7AB28A9EEKCG3DFB9968B6A-FNAJDGCCDCCD9FLJI9RgnqWhVseeMKGEKaMvpA*F**s4qW*LLLBkCLlUDSGHCc9C*HcWQtLp*NtVjC*jm*jhaUBHIJ*LNICO*mr*H*qMO*ivnM ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-257| PSIPRED cEEEEEEEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHHccHHHHHHHHcEEcccccccccccHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHccHHHHHHcccEEEEEEcccccccEEEEcc //