[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0797
DDBJ      :CPE0797      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  86/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1b.1.18
:193 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   7->188 2a96A PDBj 2e-19 16.8 %
:RPS:SCOP  102->193 1ayrA1  b.1.18.11 * 3e-10 14.9 %
:HMM:SCOP  2->176 1d2tA_ a.111.1.1 * 4.5e-29 26.7 %
:RPS:PFM   71->165 PF01569 * PAP2 7e-08 41.8 %
:HMM:PFM   64->173 PF01569 * PAP2 1.3e-22 31.8 110/129  
:HMM:PFM   15->76 PF07314 * DUF1461 0.0008 17.7 62/181  
:BLT:SWISS 1->193 YWOA_BACSU 1e-23 32.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80503.1 GT:GENE CPE0797 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(980300..980881) GB:FROM 980300 GB:TO 980881 GB:DIRECTION - GB:GENE CPE0797 GB:PRODUCT conserved hypothetical protein GB:NOTE 193 aa, similar to sp:YWOA_BACSU HYPOTHETICAL 21.7 KDA PROTEIN IN NRGB-SPOIIQ INTERGENIC REGION from Bacillus subtilis (193 aa); 32.6% identity in 193 aa overlap. 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80503.1 LENGTH 193 SQ:AASEQ MNFWNDIFNSINGLAGKNHLLDSIMLFSSKRLPYILFATVIVVYLIGIISKNKKARGIAVDTIVFTGINLILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLNRYNKALGTICVILSILMGISRVYVGHHYPQHVVASFLIVIILNVLYMKFLSKSVQKLYFSIEKHIPILNKLVK GT:EXON 1|1-193:0| BL:SWS:NREP 1 BL:SWS:REP 1->193|YWOA_BACSU|1e-23|32.3|186/193| TM:NTM 4 TM:REGION 32->51| TM:REGION 60->82| TM:REGION 117->139| TM:REGION 149->171| RP:PDB:NREP 1 RP:PDB:REP 7->188|2a96A|2e-19|16.8|179/217| RP:PFM:NREP 1 RP:PFM:REP 71->165|PF01569|7e-08|41.8|91/132|PAP2| HM:PFM:NREP 2 HM:PFM:REP 64->173|PF01569|1.3e-22|31.8|110/129|PAP2| HM:PFM:REP 15->76|PF07314|0.0008|17.7|62/181|DUF1461| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01569|IPR000326| GO:PFM GO:0016020|"GO:membrane"|PF01569|IPR000326| RP:SCP:NREP 1 RP:SCP:REP 102->193|1ayrA1|3e-10|14.9|87/182|b.1.18.11| HM:SCP:REP 2->176|1d2tA_|4.5e-29|26.7|172/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 113 OP:NHOMOORG 92 OP:PATTERN --------1---11---------------------11---------------1--------------- --------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------1-11111212422221121-1121422-------------1----------------------------------------------------------------------------------------------21222--111-11----111------------------21111------------1---------------------------------------------------------------------------------------------------------------------------1--1-1-111111----1--111-------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------1-------1--------------1-11111111111111----------1--------------------------------------------1-1111------------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 96.4 SQ:SECSTR #HHHHHHHHHHHHTT#TTcHHHHHHHHHTccccHHHHHHHHHHHHTccccTTTcHHHHHHHHHHHHHHHTTTTHHHHHHHccccHHHHHTccGGHHHHHTccccccHHHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHTcTTTcc##### PSIPRED ccHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //