[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0808
DDBJ      :CPE0808      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.118.8
:181 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  28->175 1y8mA1 a.118.8.1 * 0.00033 20.3 %
:HMM:PFM   59->126 PF05379 * Peptidase_C23 0.00012 19.1 68/89  
:HMM:PFM   1->73 PF11337 * DUF3139 0.00014 22.2 72/85  
:BLT:SWISS 68->160 Y051_NPVAC 3e-05 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80514.1 GT:GENE CPE0808 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 992576..993121 GB:FROM 992576 GB:TO 993121 GB:DIRECTION + GB:GENE CPE0808 GB:PRODUCT hypothetical protein GB:NOTE 181 aa, no significant homology. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB80514.1 LENGTH 181 SQ:AASEQ MKKFITILSVIICLGLGGLLIANHYTSLKEERFNNIIENANKAIENKEYKTAEVLLEKAKLMNNKTNVICKKIQNLEFHKEQQELYDQGLRLEKMKRYSEAIDVFSEIQDDSNDLKINSHKEIEVCKKCIIDDFSNKADKAIRRGDIERAKYIIAKIEKVDSESPEINILNMKIENFKSAK GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 68->160|Y051_NPVAC|3e-05|27.9|86/318| TM:NTM 1 TM:REGION 4->25| SEG 14->20|lglggll| SEG 34->48|nniienankaienke| HM:PFM:NREP 2 HM:PFM:REP 59->126|PF05379|0.00012|19.1|68/89|Peptidase_C23| HM:PFM:REP 1->73|PF11337|0.00014|22.2|72/85|DUF3139| HM:SCP:REP 28->175|1y8mA1|0.00033|20.3|118/0|a.118.8.1|1/1|TPR-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 178-181| PSIPRED cHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEccccHHHHHHHHHHHHHccHHHHHHHHccHHHHHHHHHHHHHHccccccEEEEEEEcccccccc //