[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0809
DDBJ      :CPE0809      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  197/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.79.7
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   57->114 2aizP PDBj 4e-04 27.6 %
:RPS:SCOP  57->114 1r1mA  d.79.7.1 * 5e-05 25.9 %
:RPS:PFM   48->177 PF02698 * DUF218 4e-23 42.9 %
:HMM:PFM   47->186 PF02698 * DUF218 9.3e-36 31.2 138/155  
:BLT:SWISS 82->195 SANA_SHIFL 3e-05 29.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80515.1 GT:GENE CPE0809 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(993161..993781) GB:FROM 993161 GB:TO 993781 GB:DIRECTION - GB:GENE CPE0809 GB:PRODUCT hypothetical protein GB:NOTE 206 aa, partially similar to prf:2316406C membrane protein from Staphylococcus gallinarum (330 aa); 38.4% identity in 151 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB80515.1 LENGTH 206 SQ:AASEQ MLKKKILVGISILIGLLILVFLIFEVFLTYKMMNFKDINQLKDVEYEIILGAGLYGDKPSPILQERLEEGLKYLELHPNTKVIVSGEQGSNEPIPESEAMKNFLVNKGINPNRIIEEDKSKSTFQNLEFSKKILEERHADKDEVLIVTSDFHLFRAKEIADYLNIKNEGLPSKTPISLRVQYMVREFPAMIKLLLQEAFLDTKDIV GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 82->195|SANA_SHIFL|3e-05|29.5|105/239| TM:NTM 1 TM:REGION 7->29| SEG 2->28|lkkkilvgisiligllilvflifevfl| RP:PDB:NREP 1 RP:PDB:REP 57->114|2aizP|4e-04|27.6|58/134| RP:PFM:NREP 1 RP:PFM:REP 48->177|PF02698|4e-23|42.9|126/150|DUF218| HM:PFM:NREP 1 HM:PFM:REP 47->186|PF02698|9.3e-36|31.2|138/155|DUF218| RP:SCP:NREP 1 RP:SCP:REP 57->114|1r1mA|5e-05|25.9|58/140|d.79.7.1| OP:NHOMO 291 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- ----2-1----11------------1-------111-2----------1---1----1-----11131-1-1111---1-21-------------------1------------------------------------------1----------------------11-----------------11---1--444445434434433--11--443---2-1122222211-1111111111111111111322122112122211111-12-1322----111111-------------------------11---111-1-121222222222311111222111-111---12-----1-11-1---1-----------------------------------------------------------1-------------------------------------------------------------------------------------------------111----------11------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1-1-1111111-1-11-------------------------------------------------------1111111111-------------------1----1------------------11111111111111----------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 28.2 SQ:SECSTR ########################################################ccccHHHHHHHHHHHHHHHHcTTccEEEEEccccHHHHHHHHHHHHHHHHTTccGGGE############################################################################################ DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHccccHHHEEEccccccHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //