[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0820
DDBJ      :CPE0820      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  346/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:275 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->274 1nf2A PDBj 2e-18 29.0 %
:RPS:PDB   3->270 3dnpA PDBj 2e-21 19.0 %
:RPS:SCOP  3->266 1nrwA  c.108.1.10 * 2e-35 23.6 %
:HMM:SCOP  1->274 1rkqA_ c.108.1.10 * 5.4e-48 26.8 %
:RPS:PFM   6->270 PF08282 * Hydrolase_3 3e-22 34.5 %
:HMM:PFM   5->270 PF08282 * Hydrolase_3 2.1e-61 34.8 250/254  
:BLT:SWISS 1->273 Y265_MYCGE 1e-20 29.4 %
:PROS 3->14|PS01228|COF_1
:PROS 224->246|PS01229|COF_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80526.1 GT:GENE CPE0820 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1004945..1005772 GB:FROM 1004945 GB:TO 1005772 GB:DIRECTION + GB:GENE CPE0820 GB:PRODUCT conserved hypothetical protein GB:NOTE 275 aa, similar to >sp:Y265_MYCGE HYPOTHETICAL PROTEIN MG265 from Mycoplasma genitalium (278 aa); 27.5% identity in 273 aa overlap GB:PROTEIN_ID BAB80526.1 LENGTH 275 SQ:AASEQ MELFVSDLDGTLLNKDQVISDYSKKELNRLISTGVNFAIATARSPATVSDILDGIDIKTPVVLMNGVIIFDIEKKKYIDVKEIDKESVKEIIKILQEYNKTFFLYGIKDDYLWVYHKDFTYDFEREYYEERCNKKLKSFKKVENYLDILDDNQIINFVFFEDNKLIAHELFEKILKVKGVTGNCYKDIYNEGAFFLDVYNEEASKANGIKFLADYVEHSKVITFGDGENDVPMFEIADECYALENASAGLKAIATGIIGNNNDDAVVRFLIERLK GT:EXON 1|1-275:0| BL:SWS:NREP 1 BL:SWS:REP 1->273|Y265_MYCGE|1e-20|29.4|255/278| PROS 3->14|PS01228|COF_1|PDOC00944| PROS 224->246|PS01229|COF_2|PDOC00944| BL:PDB:NREP 1 BL:PDB:REP 3->274|1nf2A|2e-18|29.0|252/267| RP:PDB:NREP 1 RP:PDB:REP 3->270|3dnpA|2e-21|19.0|258/268| RP:PFM:NREP 1 RP:PFM:REP 6->270|PF08282|3e-22|34.5|249/253|Hydrolase_3| HM:PFM:NREP 1 HM:PFM:REP 5->270|PF08282|2.1e-61|34.8|250/254|Hydrolase_3| RP:SCP:NREP 1 RP:SCP:REP 3->266|1nrwA|2e-35|23.6|254/285|c.108.1.10| HM:SCP:REP 1->274|1rkqA_|5.4e-48|26.8|261/271|c.108.1.10|1/1|HAD-like| OP:NHOMO 688 OP:NHOMOORG 358 OP:PATTERN --------------------------------------------------2----------------- ------11---1-----------------------------------------------------------1111---1-1------------2------21-2---1----------------1----------------111--------------------------------------------11---2222222121222232121111221-11-423666665-22222222222222222222213-3223233611--122211111235553111-11------1--1-2111121211121-11111111823148333333363633223675-323-11---------21--2223223-------------------------------------------------1----------------------------------111-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------1-111--2111------1---------------------------1-11-2322-3-3223333323-233233233323333333322311111222111221122221211222222--311111111111--1--------------111111111---211111111-1-------------------111111111111-2212-1--122444-----------------2------11111111--1----1-41334212333343211112-122-111--1- 11--11-------1-----------------------------------------------------------------------------------------1----------------------------------------------------------------------------------111-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 99.6 SQ:SECSTR ccEEEEccccccccTTccccHHHHHHHHHHHHTTcEEEEcccccHHHHHHHHHHTTccccEEEGGGTEEEcEcTTcccEEccccHHHHHHHHHHHHTcccEEEEEccccccEEEcccccccHHHHHcccccccTTTccEEEcccHHHHHHccccccEEEEEccGGGHHHHHHHHHHHTTEEEcTTEEEEEEETTEEEEEETTccHHHHHHHHHHHTTcGGEEEEEccGGGHHHHHcccEEEEcTTccHHHHHHccEEcccTTTTHHHHHHHHHH# DISOP:02AL 274-276| PSIPRED cEEEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccccEEEEccEEEEEccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEcccEEEEccccHHHHHHHHHHHHHHHccccccEEcccHHcccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcccccHHHHHHHHHHHccHHcEEEEEccccHHHHHHHcccEEEEccccHHHHHHcccccccccccHHHHHHHHHHc //