[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0828
DDBJ      :CPE0828      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:260 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   55->242 PF09529 * Intg_mem_TP0381 7e-17 37.5 %
:HMM:PFM   19->245 PF09529 * Intg_mem_TP0381 3.2e-57 32.9 222/225  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80534.1 GT:GENE CPE0828 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1011728..1012510 GB:FROM 1011728 GB:TO 1012510 GB:DIRECTION + GB:GENE CPE0828 GB:PRODUCT conserved hypothetical protein GB:NOTE 260 aa, similar to gp:AF068901_6 unknown from Streptococcus pneumoniae (234 aa); 27.4% identity in 186 aa overlap. 7 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80534.1 LENGTH 260 SQ:AASEQ MNRLLEFSNEIFRIKTDDYTFPLFSSLHFKIILCVVITIFIAIIFKEKIKKWKYRRAFEITTALILISTQIFLAIWYSRFPNFYLKESLPLYPCRIAIIMAAIGLIWKKNDFAKSIAYFWGTIGAIGALMIPITNSYIFPHITYYTFFIGHYFLLIASLYLILIEEFKVKSKNVKQALIFSFIFAICAFIANYLFDANYAFLNPPNGYEILNIINVESNIITTSIFAYFIFVLGIFIMYLPFNMSDYKKDSLFECSLIKY GT:EXON 1|1-260:0| TM:NTM 7 TM:REGION 23->45| TM:REGION 58->79| TM:REGION 86->107| TM:REGION 114->136| TM:REGION 145->167| TM:REGION 176->198| TM:REGION 215->237| SEG 30->53|kiilcvvitifiaiifkekikkwk| SEG 177->191|alifsfifaicafia| RP:PFM:NREP 1 RP:PFM:REP 55->242|PF09529|7e-17|37.5|184/224|Intg_mem_TP0381| HM:PFM:NREP 1 HM:PFM:REP 19->245|PF09529|3.2e-57|32.9|222/225|Intg_mem_TP0381| OP:NHOMO 51 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------111111111-111111------111--------------------------------------------------------------------21111111111111-------------111111111--------------------1111---11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHcccEEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHccccccccHHHHHHccc //