[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0835
DDBJ      :CPE0835      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.55.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   56->156 2gcjC PDBj 3e-04 28.1 %
:RPS:SCOP  81->156 2gcjA1  b.55.1.10 * 5e-13 28.2 %
:RPS:PFM   77->150 PF03703 * DUF304 8e-15 41.9 %
:HMM:PFM   77->153 PF03703 * DUF304 7.5e-24 35.1 77/80  
:HMM:PFM   7->83 PF11457 * DUF3021 0.00034 31.3 67/137  
:BLT:SWISS 53->151 YDBS_BACSU 7e-13 32.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80541.1 GT:GENE CPE0835 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1023868..1024365 GB:FROM 1023868 GB:TO 1024365 GB:DIRECTION + GB:GENE CPE0835 GB:PRODUCT conserved hypothetical protein GB:NOTE 165 aa, similar to pir:E69772 hypothetical protein ydbS from Bacillus subtilis (159 aa); 36.4% identity in 99 aa overlap. Putative N-terminal signal sequence and 1 putative transmembrane region were found by PSORT GB:PROTEIN_ID BAB80541.1 LENGTH 165 SQ:AASEQ MEKKLSNKAIKSWILGRTIGLIVLVIIYLGIIFVLPKMDIQWADYILNNHMKIVNILSFIILGITALSAYIEPFFEYKQWSYRIDEEEIFFTEGVFFKKSVTIPIVRIQNINLSEGPVNRKFNLADVKIGTAGGSYKIPNLDKEEVEKIREFLRIKINENVREEL GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 53->151|YDBS_BACSU|7e-13|32.3|99/159| TM:NTM 2 TM:REGION 18->40| TM:REGION 50->72| SEG 19->35|iglivlviiylgiifvl| BL:PDB:NREP 1 BL:PDB:REP 56->156|2gcjC|3e-04|28.1|96/231| RP:PFM:NREP 1 RP:PFM:REP 77->150|PF03703|8e-15|41.9|74/78|DUF304| HM:PFM:NREP 2 HM:PFM:REP 77->153|PF03703|7.5e-24|35.1|77/80|DUF304| HM:PFM:REP 7->83|PF11457|0.00034|31.3|67/137|DUF3021| RP:SCP:NREP 1 RP:SCP:REP 81->156|2gcjA1|5e-13|28.2|71/229|b.55.1.10| OP:NHOMO 100 OP:NHOMOORG 80 OP:PATTERN ------------------------1-----1---------------1--------------------- -------------------------------------------------------------------1-----------11-1-------------------------1-----------------------------------------------------------------------------------1122222122122222221111221211-111-1111111--1111111111111111111---------------11----11-----------------------------------------------------------1-1--111221-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 58.2 SQ:SECSTR #######################################################HHHHHHHHHHcccEEcccccccTEEEETTEEEEEEEcccEEEcccEEEETTcEEEEEEEc####cEEEE#EEEEcTTccEEEEEEEEGGGHHHHHHHHHHT######### DISOP:02AL 1-8, 160-165| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEccEEEEEEEEEEEEEEEEEEEcEEEEEEEEcHHHHHHcEEEEEEEEccccEEEccccHHHHHHHHHHHHHHHHHHHHccc //