[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0845
DDBJ      :CPE0845      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:203 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 29->158 DYHC_NEUCR 2e-04 23.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80551.1 GT:GENE CPE0845 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1031779..1032390) GB:FROM 1031779 GB:TO 1032390 GB:DIRECTION - GB:GENE CPE0845 GB:PRODUCT hypothetical protein GB:NOTE 203 aa, no significant homology. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB80551.1 LENGTH 203 SQ:AASEQ MKRKLIALSLSISILSGTFFTLPIDKNVYANDLKNEGKYQDEIVLLDEEIYLDKEQLELFKQNALVEEKNSLGRSFSSDYNTYVQKSVSKSEAIQIISAYDKVTGMIDNLGFTIGGSTLVASISKSSRYRNAKNFITKYGSWGGNIILVTSFVAYKSIGKFKGEVQNAVYKMNSYDKLLFRVESATNLQDSGMCRYKLVVQKR GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 29->158|DYHC_NEUCR|2e-04|23.1|117/4367| SEG 5->16|lialslsisils| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccEEEEEEEEEEEEccEEEEEEcccccHHHccccccccccEEEEEcHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHHcccHHEEEEEEcccccccccccEEEEEEEEcc //