[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0870
DDBJ      :CPE0870      two-component sensor histidine kinase
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  365/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.122.1d.123.1
:372 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   269->369 3d36B PDBj 2e-09 29.3 %
:RPS:PDB   249->369 2e0aB PDBj 3e-17 16.8 %
:RPS:SCOP  240->369 1bxdA  d.122.1.3 * 1e-16 18.8 %
:HMM:SCOP  172->224 1ixmA_ d.123.1.1 * 0.00065 20.8 %
:HMM:SCOP  234->369 1r62A_ d.122.1.3 * 2.6e-27 31.8 %
:RPS:PFM   270->369 PF02518 * HATPase_c 6e-10 32.0 %
:HMM:PFM   266->369 PF02518 * HATPase_c 1.3e-24 34.6 104/111  
:HMM:PFM   99->136 PF00980 * Rota_Capsid_VP6 0.00049 36.8 38/396  
:HMM:PFM   145->179 PF02699 * YajC 0.00067 28.6 35/83  
:BLT:SWISS 161->353 CITS_BACHD 1e-13 28.0 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80576.1 GT:GENE CPE0870 GT:PRODUCT two-component sensor histidine kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1070334..1071452) GB:FROM 1070334 GB:TO 1071452 GB:DIRECTION - GB:GENE CPE0870 GB:PRODUCT two-component sensor histidine kinase GB:NOTE 372 aa, similar to gpu:AP001520_63 two-component sensor histidine kinase from Bacillus halodurans (538 aa); 28% identity in 193 aa overlap. Putative N-terminal signal sequence and 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80576.1 LENGTH 372 SQ:AASEQ MISLTTFFMGNSSVATLILHLVMLIIGGLIYKDDFLAAAIGFSLIYSLIVITLIISSFLYNILSQNISLINKSNIFFITIMYFPQYILAFLVLYKKKSIYSLYKTIKSRNSSIIYLILFTIVLDFIASFNAIINAKDNPIFTEIILTLLFIFIIFIIIYFSNIEKKSKEIELLNSNLEQNISSLRKLKHDYGSQISYLYGLHLMGNYEKLGELLKNIIDGNDNIINNIVVSNDTSIISMIVNTINLKDITVFIDENADLLETNVNELDFQRIVSNILRNSIEALDGSGSIKINTYYSFNYFVLKIQNNGPEIPDKILNKIFDSGFTTKENKESNNGFGLAIVKELVESYNGKIQVSSTDEFTEFTIYLPTIK GT:EXON 1|1-372:0| BL:SWS:NREP 1 BL:SWS:REP 161->353|CITS_BACHD|1e-13|28.0|186/538| COIL:NAA 26 COIL:NSEG 1 COIL:REGION 164->189| TM:NTM 5 TM:REGION 11->33| TM:REGION 41->63| TM:REGION 73->94| TM:REGION 111->133| TM:REGION 140->162| SEG 93->108|lykkksiyslyktiks| SEG 140->158|ifteiiltllfifiifiii| SEG 216->238|niidgndniinnivvsndtsiis| BL:PDB:NREP 1 BL:PDB:REP 269->369|3d36B|2e-09|29.3|99/221| RP:PDB:NREP 1 RP:PDB:REP 249->369|2e0aB|3e-17|16.8|119/353| RP:PFM:NREP 1 RP:PFM:REP 270->369|PF02518|6e-10|32.0|100/112|HATPase_c| HM:PFM:NREP 3 HM:PFM:REP 266->369|PF02518|1.3e-24|34.6|104/111|HATPase_c| HM:PFM:REP 99->136|PF00980|0.00049|36.8|38/396|Rota_Capsid_VP6| HM:PFM:REP 145->179|PF02699|0.00067|28.6|35/83|YajC| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02518|IPR003594| RP:SCP:NREP 1 RP:SCP:REP 240->369|1bxdA|1e-16|18.8|128/161|d.122.1.3| HM:SCP:REP 172->224|1ixmA_|0.00065|20.8|53/179|d.123.1.1|1/1|Sporulation response regulatory protein Spo0B| HM:SCP:REP 234->369|1r62A_|2.6e-27|31.8|132/156|d.122.1.3|1/1|ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase| OP:NHOMO 760 OP:NHOMOORG 373 OP:PATTERN -----------------------2------2----1-1---------1-1-----------------5 -31-1------------11-1---1111111-11111111-1-1---------------------------------------1-12-112--2------112--22--1----------------1-1----13--11--211--4-13--111----------1-1221-----------------12-11-445465463566766121131665-113---1221-186-11111111111111-------11211-2131111222--111---111-----------------------------------------1A3-E5555435526244413321-3---2--23384422241224-1---7----1-------1--------------------1-11111111----1--1--121-11----------------------------1---------------------------------1--------111111-----22-1------2--11------------------2-------------------11-783-131-35222-143741311-----1221---1----------------1--1--1111-22-211--111---211-11--111-------------2211-113223333423-2432333233233223222112111-11111111111111111121222231-211111111111---------------1----------------------------1---------1111-------1-------22211111-4111----------------1-884555----------1-------------------------1-1--1-1111-- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 134 STR:RPRED 36.0 SQ:SECSTR ##############################################################################################################################################################################################################################################HHHHHccEEEEEEEcccTTcccEEEEcHHHHHHHHHHHHHHHHHHHHHHTTTcEEEEEcccEEEEEEEEccccccHHHHGGGGcTTcccccccccccccHHHHHHHHHHHTTcEEEEEEETTEEEEEEEEEcHc DISOP:02AL 1-2, 169-180| PSIPRED cEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEcHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccEEEEEEEEccccccHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHccEEEEEEEccEEEEEEEEcccc //