[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0876
DDBJ      :CPE0876      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:147 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   53->139 1qsmD PDBj 3e-05 29.9 %
:RPS:PDB   4->135 2beiB PDBj 6e-13 13.3 %
:RPS:SCOP  4->146 1yk3A1  d.108.1.1 * 1e-12 14.7 %
:HMM:SCOP  1->147 2b5gA1 d.108.1.1 * 4.8e-23 30.3 %
:HMM:PFM   59->134 PF00583 * Acetyltransf_1 1.8e-11 22.4 76/83  
:BLT:SWISS 80->139 TTR_PSESZ 7e-07 35.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80582.1 GT:GENE CPE0876 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1076721..1077164 GB:FROM 1076721 GB:TO 1077164 GB:DIRECTION + GB:GENE CPE0876 GB:PRODUCT hypothetical protein GB:NOTE 147 aa, partially similar to sp:TTR_PSESY ACETYLTRANSFERASE (EC 2.3.1.-) (TABTOXIN RESISTANCE PROTEIN) from Pseudomonas syringae pv. tabaci (177 aa); 35% identity in 60 aa overlap GB:PROTEIN_ID BAB80582.1 LENGTH 147 SQ:AASEQ MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLEQWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELIMMRKKLK GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 80->139|TTR_PSESZ|7e-07|35.0|60/177| BL:PDB:NREP 1 BL:PDB:REP 53->139|1qsmD|3e-05|29.9|87/152| RP:PDB:NREP 1 RP:PDB:REP 4->135|2beiB|6e-13|13.3|128/157| HM:PFM:NREP 1 HM:PFM:REP 59->134|PF00583|1.8e-11|22.4|76/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 4->146|1yk3A1|1e-12|14.7|143/198|d.108.1.1| HM:SCP:REP 1->147|2b5gA1|4.8e-23|30.3|145/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 28 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------1--------------------------------------11---111-----111121211111---11111------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 100.0 SQ:SECSTR TEEEEEccGGGHHHHHHHHHHHHHHTGGGccccHHHHHHHHHcHHHHcccccEEEEEEccEEEEEEEEEEEETTTEEEEEEEEEEEGGGTTccHHHHHHHHHHHHHHHTTcccEEEcccTTcHHHHHHHHHTcccEEEEEEEEEEcc PSIPRED cccEEcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEEEEcccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHcccEEEEEEEEEEEEcc //