[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0885
DDBJ      :CPE0885      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:549 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 69->220 MEPA_STAAB 2e-04 24.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80591.1 GT:GENE CPE0885 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1087988..1089637 GB:FROM 1087988 GB:TO 1089637 GB:DIRECTION + GB:GENE CPE0885 GB:PRODUCT hypothetical protein GB:NOTE 549 aa, no significant homology. GB:PROTEIN_ID BAB80591.1 LENGTH 549 SQ:AASEQ MKKDKSLAVVHRLRGVYEKLGVDYEMMRLILETKLTMDRRREHTINMNNKSSDEKDNSFGKALILYGVMGAFMSMLIIIKQNIMLQMAVYFGFFMFVIGSSFIADFAYVLLDVRDKNLLGITGVSSKTINAAKITNILIYMTKLSLAYGGVGILVSLRYGILFTIVFILEIILINLFMILITAFIYYLVLKFFNGEKLKDIINVVQIVLTVGIMIMYQLVGRLFDILDVGSRFAITSWWQGFIAPLWFAAPLEIIESGVIDRTLIIFTGLAVLAPILSILIYFKIAKKFEDYIQKLNDNTYKGKDRIPFSFKIGNLVCRSNTEKSFFNFTVNIIKSERNFKLKTYPNIAMSLVFPFIFLFNFIRSYESFADWKNHMASSNEFFTLYICIFMLTPVILMVKYSDQFKASWIYKAVPIDDMASIFKGVYKGVFYKMILPVYIVLALVYLWVFGLRIIPQIIAILFVIIILNLITVKLMDKHLPFSVSFKDGEKMDDLGITLFIFMLSAIFGVVHYIINRLNYGVYIFIFIELILIGILWTIISKSKYHKIN GT:EXON 1|1-549:0| BL:SWS:NREP 1 BL:SWS:REP 69->220|MEPA_STAAB|2e-04|24.5|147/451| TM:NTM 12 TM:REGION 59->81| TM:REGION 89->111| TM:REGION 134->156| TM:REGION 168->190| TM:REGION 203->225| TM:REGION 230->252| TM:REGION 256->278| TM:REGION 345->367| TM:REGION 380->402| TM:REGION 443->465| TM:REGION 494->516| TM:REGION 520->542| SEG 454->471|iipqiiailfviiilnli| SEG 524->536|ififieliligil| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------11---------11----------------------------------------------------------111111--1---11111--1--------------1------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 44-58, 547-549| PSIPRED cccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHcEEEEccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccc //