[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0888
DDBJ      :CPE0888      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  80/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->205 1nqzA PDBj 7e-08 28.2 %
:RPS:PDB   22->207 3dupA PDBj 1e-10 10.1 %
:RPS:SCOP  7->205 1nqyA  d.113.1.1 * 2e-26 28.5 %
:HMM:SCOP  25->206 1nqzA_ d.113.1.1 * 3.4e-26 31.4 %
:RPS:PFM   55->78 PF00293 * NUDIX 1e-04 54.2 %
:HMM:PFM   41->150 PF00293 * NUDIX 1.5e-15 29.5 105/135  
:BLT:SWISS 2->200 NUDT7_MOUSE 1e-14 31.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80594.1 GT:GENE CPE0888 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1091766..1092416 GB:FROM 1091766 GB:TO 1092416 GB:DIRECTION + GB:GENE CPE0888 GB:PRODUCT conserved hypothetical protein GB:NOTE 216 aa, similar to gpu:AP001511_170 BH1281 gene product from Bacillus halodurans (207 aa); 33% identity in 209 aa overlap GB:PROTEIN_ID BAB80594.1 LENGTH 216 SQ:AASEQ MNNIENIKDIFRDYRIGINGEEDMKRCSVLIQVVNIDGEDNIIFEIRNNKLNSNPGEICFPGGAIEEGETPKEAALRECFEEIGLGEENLEIISQLDFYVSPNNILIYPFLGVQKNQKENIKNLISINKEEVSHILLVPLKYLLNYEPEITYSKIINMPKEDFPFHNIIGGKDYKFRDGRYKVMFYKYNNFVIWGMTARILENFLNVYKEHYNKNI GT:EXON 1|1-216:0| BL:SWS:NREP 1 BL:SWS:REP 2->200|NUDT7_MOUSE|1e-14|31.7|180/236| SEG 81->93|eeiglgeenleii| BL:PDB:NREP 1 BL:PDB:REP 25->205|1nqzA|7e-08|28.2|149/171| RP:PDB:NREP 1 RP:PDB:REP 22->207|3dupA|1e-10|10.1|159/279| RP:PFM:NREP 1 RP:PFM:REP 55->78|PF00293|1e-04|54.2|24/132|NUDIX| HM:PFM:NREP 1 HM:PFM:REP 41->150|PF00293|1.5e-15|29.5|105/135|NUDIX| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00293|IPR000086| RP:SCP:NREP 1 RP:SCP:REP 7->205|1nqyA|2e-26|28.5|165/170|d.113.1.1| HM:SCP:REP 25->206|1nqzA_|3.4e-26|31.4|156/187|d.113.1.1|1/1|Nudix| OP:NHOMO 92 OP:NHOMOORG 90 OP:PATTERN ----------------------------1--------------------------------------- ------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------1----------------11--1--------111------1--------------------------------------------------11-1--------------1--1-1111-111-1111-1111-11-11111111111-1111111-1-1---------111-1-------1-----------------------------------------------1-------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-------1---1------------------------------------1------------1-1--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111-----------------------------------------------------------------11111-------- -------------------------------------------------------------------------------------------------------1-------------1-----13-----------1----------------11----------------11-------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 209 STR:RPRED 96.8 SQ:SECSTR cccTTTccEEEEEEEEETTccTccEEEEEEEEEEccGGGcEEEEEEEcTTccccTTcEEEEEEEccTTccHHHHHHHHHHHHHcccHHHHTTcEEEEEEETTEEEEEEEEEEEEEccTTGcccccccccTTccEEEEEEHHHHHHHHHHHHHccEHHHcccccTTHHHHHHHHHHHHcccccHHHHHHHTTcccTTTcTTHHHHHHHTT####### DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHcccccccccccccEEEEEEEEEEccccEEEEEEEcccccccccEEEcccccccccccHHHHHHHHHHHHHcccEEEEEEEEEEccccccccEEEEEEEEEEccccccccccccccHHHHHHHEEccHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccEEEEEEHHHHHHHHHHHHHHHccccc //