[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0891
DDBJ      :CPE0891      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   34->92 PF09335 * SNARE_assoc 6e-05 36.2 %
:HMM:PFM   32->106 PF09335 * SNARE_assoc 9.6e-16 32.0 75/123  
:BLT:SWISS 50->106 Y364_MYCTU 2e-06 35.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80597.1 GT:GENE CPE0891 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1093462..1093917 GB:FROM 1093462 GB:TO 1093917 GB:DIRECTION + GB:GENE CPE0891 GB:PRODUCT hypothetical protein GB:NOTE 151 aa, similar to pir:B81322 probable integral membrane protein (dedA homolog) Cj1168c from Campylobacter jejuni (strain NCTC 11168) (200 aa); 38.2% identity in 76 aa overlap. Truncated by frameshift mutation (confirmed by PCR-direct sequencing). 2 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80597.1 LENGTH 151 SQ:AASEQ MCFANIRYRRRSWHPNKLFCGNVCRKKVISFAKRKHKKSKSIFEKIDRLFSRYGKITVFLARLLPFTRTYISLFAGAEKVNKIMFVIFSALGITIMDSFYLLLGYFAYDNKSFIEKALRHYSIALIIIIVIAIFSYYIYKNLKLKKLKKEN GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 50->106|Y364_MYCTU|2e-06|35.1|57/227| TM:NTM 2 TM:REGION 79->101| TM:REGION 118->140| SEG 121->149|ysialiiiiviaifsyyiyknlklkklkk| RP:PFM:NREP 1 RP:PFM:REP 34->92|PF09335|6e-05|36.2|58/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 32->106|PF09335|9.6e-16|32.0|75/123|SNARE_assoc| OP:NHOMO 25 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111--------------------------------------------------------------------------------------------2----------------11-333-----------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 147-151| PSIPRED ccccHHHHHHHccccccEEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //