[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0920
DDBJ      :CPE0920      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->66 PF02516 * STT3 0.0002 25.0 52/658  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80626.1 GT:GENE CPE0920 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1120741..1120959) GB:FROM 1120741 GB:TO 1120959 GB:DIRECTION - GB:GENE CPE0920 GB:PRODUCT hypothetical protein GB:NOTE 72 aa, no significant homology. Putative N-terminal signal sequence and 1 putative transmembrane region were found by PSORT GB:PROTEIN_ID BAB80626.1 LENGTH 72 SQ:AASEQ MKDENINIKYQNKVNLIFIILVTISFLLYRFVFDRNGNLLSLNYILIYFVVLVLVISSLINFIKGKTRNKDN GT:EXON 1|1-72:0| TM:NTM 2 TM:REGION 12->34| TM:REGION 41->63| SEG 42->63|lnyiliyfvvlvlvisslinfi| HM:PFM:NREP 1 HM:PFM:REP 14->66|PF02516|0.0002|25.0|52/658|STT3| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 67-72| PSIPRED cccccccEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHHccccccccc //